Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0277605 (DDB_G0277605)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Dictyostelium discoideum Uncharacterized protein DDB_G0277605, also known as DDB_G0277605 protein, is a protein derived from the slime mold Dictyostelium discoideum . Dictyostelium discoideum is valuable in cell and developmental biology research due to its simple life cycle . The protein DDB_G0277605 is expressed in E. coli and tagged with histidine (His) .

Properties

PropertyDescription
SpeciesDictyostelium discoideum
SourceE. coli
TagHis (N-terminal)
Protein LengthFull Length (1-154 amino acids)
FormLyophilized powder
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, avoid repeated freeze-thaw cycles
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionReconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL; add 5-50% glycerol for long-term storage at -20℃/-80℃
Gene NameDDB_G0277605
SynonymsDDB_G0277605, Uncharacterized protein DDB_G0277605
UniProt IDQ86KR1
Amino Acid SequenceMDNLKEKPLSYNINNNNLNNNNNNNNNNNNNNNNINNNINNNNFKYVSFSESLEDIGYQNQYIIDKDEDYYIQEQRYIRQNNQSDDEEDFNNNNYEDSIKISLIQKSFIKNKKNKIIITTIVVLLMIAVSLGLILAWQGVFDQIHNNNNNSKDE

Function and Significance

The precise function of DDB_G0277605 is currently uncharacterized . Many proteins in Dictyostelium discoideum are rich in glutamine (Q) and asparagine (N), making them prone to aggregation, yet Dictyostelium discoideum exhibits resilience to protein aggregation, suggesting specific adaptations in its proteostasis mechanisms . Further research is needed to elucidate the role of DDB_G0277605 in Dictyostelium discoideum.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0277605; Uncharacterized protein DDB_G0277605
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0277605
Target Protein Sequence
MDNLKEKPLSYNINNNNLNNNNNNNNNNNNNNNNINNNINNNNFKYVSFSESLEDIGYQN QYIIDKDEDYYIQEQRYIRQNNQSDDEEDFNNNNYEDSIKISLIQKSFIKNKKNKIIITT IVVLLMIAVSLGLILAWQGVFDQIHNNNNNSKDE
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism for studying uncharacterized proteins?

Dictyostelium discoideum is a social amoeba with a unique life cycle comprising both unicellular and multicellular phases, making it an excellent model for studying various fundamental cellular and developmental processes. Its genome is fully sequenced with low redundancy, providing a less complex system while maintaining many genes and signaling pathways found in more complex eukaryotes . The haploid nature of Dictyostelium's genome allows researchers to introduce one or multiple gene disruptions with relative ease, facilitating functional studies with measurable phenotypic outcomes . Additionally, Dictyostelium development shares many features with metazoan development but occurs in a much shorter timeframe (24 hours), allowing for rapid detection of developmental phenotypes . These characteristics make it particularly valuable for studying uncharacterized proteins like DDB_G0277605, as functional analyses can be conducted efficiently through genetic manipulation, phenotypic assays, and protein localization studies.

How should recombinant DDB_G0277605 be handled and stored for optimal stability and activity?

Storage ConditionRecommended ProtocolNotes
Long-term Storage-20°C/-80°CAliquoting necessary for multiple use
Working Aliquots4°CUse within one week
Storage BufferTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
ReconstitutionDeionized sterile water0.1-1.0 mg/mL concentration recommended
Glycerol Addition5-50% (final concentration)50% is the default recommendation

For optimal handling, briefly centrifuge the vial before opening to bring contents to the bottom . Avoid repeated freeze-thaw cycles as this can lead to protein denaturation and activity loss . After reconstitution, add glycerol to the recommended concentration and create working aliquots to minimize freeze-thaw cycles . When planning experiments, consider the stability of the protein at working temperatures and optimize buffer conditions if necessary for specific assay requirements.

What approaches can be used to begin characterizing the potential function of DDB_G0277605?

ApproachMethodologyExpected Outcome
Sequence AnalysisBioinformatic tools (BLAST, PFAM, InterPro)Identification of conserved domains, homologs in other species
Subcellular LocalizationFluorescent tagging, immunofluorescenceCellular compartment indication, potential function hints
Expression ProfilingRT-PCR, RNA-seq during developmentTemporal expression patterns during life cycle stages
Gene DisruptionCRISPR-Cas9, insertional mutagenesisPhenotypic effects indicating functional pathways
Protein Interaction StudiesCo-immunoprecipitation, yeast two-hybridIdentification of binding partners suggesting functional networks

Begin with bioinformatic analyses to identify potential homologs and functional domains. The transmembrane region suggests a potential membrane-associated function, possibly in signaling or transport. Consider developing fluorescently tagged constructs to determine subcellular localization, as Dictyostelium offers excellent opportunities for studying protein localization and function through various expression constructs . Generate knockout strains using CRISPR-based gene disruption techniques, which have been successfully applied in Dictyostelium . Examine phenotypes across the 24-hour developmental cycle to identify potential roles in specific developmental stages .

How can CRISPR-based gene disruption be effectively applied to study DDB_G0277605 function in Dictyostelium?

CRISPR-based gene disruption represents a powerful approach for studying gene function in Dictyostelium. According to the research topic referenced in the Frontiers editorial, Yamashita et al. describe specific applications of CRISPR for gene disruption in Dictyostelium . When applying this technique to DDB_G0277605, researchers should:

  • Design sgRNAs targeting multiple regions of the DDB_G0277605 gene to ensure disruption

  • Optimize Cas9 expression for Dictyostelium's AT-rich genome

  • Use appropriate selectable markers for transformant selection

  • Verify knockout through genomic PCR, RT-PCR, and Western blotting

  • Characterize phenotypes through:

    • Growth rate assessment

    • Development on non-nutrient agar

    • Cell motility and chemotaxis assays

    • Phagocytosis efficiency

    • Resistance to various stressors

This approach should be coupled with a rescue experiment using the recombinant protein or a re-expression construct to confirm that phenotypic changes are specifically due to the absence of DDB_G0277605 . The phenotypic analysis should span Dictyostelium's complete life cycle, as changes may be apparent only during specific developmental stages.

How does the predicted transmembrane domain in DDB_G0277605 inform potential functional hypotheses?

The amino acid sequence of DDB_G0277605 contains a putative transmembrane domain (approximately residues 118-140: IVVLLMIAVSLGLILAWQG), suggesting it may function as a membrane protein . This structural feature raises several functional hypotheses:

Potential FunctionSupportive FeaturesExperimental Approach
Cell Signaling ReceptorSingle transmembrane domain, cytoplasmic N-terminal region with potential interaction domainsLigand binding assays, phosphorylation studies
Membrane TransportTransmembrane domain, potential for forming channels/poresElectrophysiology, transport assays
Cell AdhesionMembrane localization during developmental stagesCell-cell adhesion assays during development
Mitochondrial/ER Membrane ProteinPotential targeting sequencesOrganelle isolation, localization studies
Pathogen RecognitionMembrane localization similar to other pattern recognition receptorsBacterial challenge assays

To investigate these hypotheses, generate fluorescently tagged versions of DDB_G0277605 and examine localization during the unicellular and multicellular phases of Dictyostelium development. Compare expression and localization patterns during bacterial feeding, starvation-induced development, and cell migration. Given Dictyostelium's established role in studying phagocytosis and bacterial killing , the potential involvement of DDB_G0277605 in pathogen interaction would be particularly interesting to investigate.

What experimental approaches can link DDB_G0277605 to specific cellular processes studied in Dictyostelium?

Cellular ProcessExperimental ApproachRationale
ChemotaxisMicropipette assay, under-agarose assay with DDB_G0277605 knockout cellsDictyostelium is a model for studying eukaryotic chemotaxis
PhagocytosisBacterial/particle uptake assaysMembrane proteins often participate in pathogen recognition and uptake
AutophagyMonitoring autophagic flux in knockout cellsDictyostelium is widely used for autophagy studies
Cell DifferentiationDevelopmental timing analysis of knockout strainsThe 24-hour developmental cycle allows rapid phenotype detection
Host-Pathogen InteractionsBacterial challenge assaysDictyostelium is used to study mechanisms of bacterial sensing and killing

For each approach, compare wild-type, knockout, and rescue strains. Document phenotypes at each stage of the 24-hour developmental cycle, as effects may be stage-specific. Consider employing high-throughput genetic screens similar to those described by Williams et al. to identify genetic interactions with DDB_G0277605. Additionally, investigate potential involvement in specialized Dictyostelium processes like Bodinier et al.'s described mechanism for sensing, phagocytosis, and killing of bacteria, which is regulated by the leucine-rich repeat kinase LrrkA .

How should experiments be designed to study DDB_G0277605 localization in Dictyostelium cells?

When designing experiments to study DDB_G0277605 localization in Dictyostelium, researchers should:

  • Create fluorescent protein fusions:

    • N-terminal tagging (consider potential interference with signal sequences)

    • C-terminal tagging (consider potential interference with the transmembrane domain)

    • Internal tagging at neutral sites if terminal tagging affects function

  • Select appropriate microscopy techniques:

    • Confocal microscopy for high-resolution subcellular localization

    • Live-cell imaging to track dynamic changes during development

    • Super-resolution techniques for detailed membrane organization

  • Utilize appropriate co-localization markers:

    • Plasma membrane markers (e.g., PH domains)

    • Organelle markers (ER, Golgi, mitochondria, endosomes)

    • Cytoskeletal components during migration

  • Examine localization across Dictyostelium's life cycle:

    • Unicellular growth phase

    • Early aggregation

    • Mound formation

    • Slug stage

    • Culmination and fruiting body formation

Experiments should include controls for tag-only expression and native promoter versus overexpression constructs. Consider using the variety of expression constructs available for Dictyostelium that enable studies on protein localization, as referenced by Levi et al., Veltman et al., and Müller-Taubenberger and Ishikawa-Ankerhold . Document localization changes during key transitions, especially the unicellular-to-multicellular transition, as this could provide insights into potential developmental functions.

What controls are essential when working with recombinant DDB_G0277605 in functional assays?

Control TypeImplementationPurpose
Positive ControlsKnown functional domain proteinsValidate assay performance
Negative ControlsBuffer-only, unrelated protein with similar propertiesEstablish baseline, identify non-specific effects
Tag-Only ControlsHis-tag peptide or proteinDetermine tag contribution to observed effects
Denatured Protein ControlHeat-inactivated DDB_G0277605Confirm activity requires native conformation
Concentration ControlsSerial dilutions of recombinant proteinEstablish dose-response relationships
Time Course ControlsMultiple time points for activity measurementDetermine kinetic parameters
Species Specificity ControlsOrthologous proteins from related speciesAssess evolutionary conservation of function

When designing functional assays for DDB_G0277605, consider its potential membrane association and design experiments accordingly. For binding studies, use appropriate membrane models or cellular fractions. For biochemical assays, ensure buffer conditions maintain protein stability and prevent aggregation. When interpreting results, remember that the recombinant protein is produced in E. coli and may lack post-translational modifications present in native Dictyostelium , potentially affecting function.

How can researchers effectively design knockout experiments for DDB_G0277605?

Designing effective knockout experiments for DDB_G0277605 requires careful consideration of Dictyostelium's unique genetic properties:

  • Knockout Strategy Selection:

    • CRISPR-Cas9 system as described by Yamashita et al.

    • Homologous recombination with selectable markers

    • Insertional mutagenesis libraries as mentioned in the editorial

  • Essential Controls:

    • Wild-type parental strain

    • Random integrant controls (transfection control)

    • Rescue strain expressing DDB_G0277605

    • Double knockouts with potential interacting partners

  • Phenotypic Analysis Framework:

    • Growth curves in axenic media and with bacterial food source

    • Complete development cycle documentation (all stages in Fig. 1A)

    • Specific assays based on predicted function (phagocytosis, motility)

    • Stress response tests (osmotic, oxidative, nutritional)

  • Molecular Validation:

    • Genomic PCR to confirm integration

    • RT-PCR to confirm transcript absence

    • Western blotting if antibodies are available

    • Whole transcriptome analysis to identify compensatory changes

The experimental design should leverage Dictyostelium's rapid 24-hour developmental cycle to efficiently assess phenotypes at each stage . Document the aggregation, mound formation, slug motility, and fruiting body formation phases carefully, as defects may be stage-specific. Consider the potential redundancy of gene function, as even uncharacterized genes may have paralogs with overlapping functions.

How should researchers analyze potential developmental phenotypes in DDB_G0277605 knockout strains?

Analysis of developmental phenotypes in DDB_G0277605 knockout strains should follow a systematic approach based on Dictyostelium's well-characterized developmental cycle:

  • Quantitative Metrics for Each Developmental Stage:

    • Timing of aggregation initiation (hours post-starvation)

    • Stream formation efficiency (percentage of cells in streams)

    • Mound size and number per unit area

    • Slug motility rate and directionality

    • Culmination timing and efficiency

    • Fruiting body morphology and spore viability

  • Statistical Analysis Approaches:

    • ANOVA for multi-stage comparisons between strains

    • Repeated measures analysis for time course experiments

    • Kaplan-Meier analysis for developmental timing

    • Image analysis algorithms for morphological quantification

  • Integration with Molecular Data:

    • Correlation of phenotypes with gene expression changes

    • Pathway analysis based on transcriptomic data

    • Protein interaction networks if binding partners are identified

When interpreting results, consider the context of Dictyostelium's developmental program as illustrated in Figure 1A of the editorial . Compare observed phenotypes with those of known developmental mutants to identify potential shared pathways. Document all abnormalities across the complete 24-hour developmental cycle, as subtle changes in early stages may significantly impact later development. Consider using advanced imaging techniques to quantify morphological changes objectively.

What approaches can help researchers distinguish between direct and indirect effects in DDB_G0277605 functional studies?

Distinguishing between direct and indirect effects in functional studies requires multiple complementary approaches:

ApproachMethodologyOutcome
Acute Protein AdditionApply purified recombinant protein to live cellsImmediate effects suggest direct action
Inducible ExpressionTetracycline-controlled gene expressionTemporal relationship between expression and phenotype
Domain Mutation AnalysisTargeted mutations in functional domainsStructure-function relationships
Binding Partner IdentificationCo-immunoprecipitation, proximity labelingDirect interaction network
Temporal TranscriptomicsRNA-seq at multiple timepoints after inductionPrimary vs. secondary response genes
Pharmacological ValidationSpecific inhibitors of predicted pathwaysPathway requirement confirmation
In Vitro ReconstitutionPurified components in biochemical assaysDirect biochemical activity

For DDB_G0277605, which contains a putative transmembrane domain , consider membrane-specific approaches like liposome reconstitution or membrane permeabilization assays. Use the recombinant protein in direct binding studies with potential partners identified through genetic or proteomic screens. When interpreting results, consider the protein's potential role in established Dictyostelium signaling networks involved in processes like chemotaxis, phagocytosis, or development .

How can researchers integrate data from different experimental approaches to build a comprehensive understanding of DDB_G0277605 function?

Integrating data from multiple experimental approaches requires a systematic framework:

  • Data Integration Hierarchy:

    • Sequence-based predictions and structural modeling

    • Localization and expression patterns across development

    • Protein interaction networks

    • Knockout phenotypes across conditions

    • Biochemical activity assays

    • System-level effects (transcriptomics, proteomics)

  • Cross-Validation Strategies:

    • Confirm interactions using both in vivo and in vitro methods

    • Validate phenotypes with multiple knockout methods and rescue experiments

    • Test predictions from computational analyses with targeted experiments

    • Correlate expression patterns with temporal appearance of phenotypes

  • Pathway Placement:

    • Compare phenotypes with known pathway mutants

    • Use epistasis analysis with established pathway components

    • Apply pharmacological modulators of candidate pathways

    • Examine conservation in other Dictyostelium species and beyond

Given Dictyostelium's established role as a model for studying fundamental processes like chemotaxis, cell movement, differentiation, and autophagy , frame the function of DDB_G0277605 within these contexts. Consider potential roles in specialized processes like bacterial sensing and killing, as described by Bodinier et al. , or in developmental signaling pathways crucial for the multicellular phase of the Dictyostelium life cycle .

What are common challenges in expressing and purifying recombinant DDB_G0277605 and how can they be addressed?

ChallengePotential CausesSolution Strategies
Poor Expression YieldCodon usage bias, toxicityCodon optimization, lower induction temperature, use of different E. coli strains
Protein InsolubilityTransmembrane domain, improper foldingDetergent screening, fusion tags, inclusion body refolding protocols
Protein AggregationImproper buffer conditions, concentrationOptimize buffer components, add stabilizing agents like trehalose
Proteolytic DegradationSensitive protease sitesAdd protease inhibitors, modify purification protocol, reduce purification time
Tag InterferenceHis-tag affecting structure/functionCompare N-terminal vs C-terminal tagging, consider tag removal
Low PurityNon-specific binding to resinOptimize imidazole concentration, add salt/detergent, consider two-step purification
Activity LossDenaturation during purificationGentle elution conditions, avoid freeze-thaw cycles

When working with DDB_G0277605, pay particular attention to its transmembrane domain, which may cause solubility issues . Consider using mild detergents or lipid nanodiscs to maintain native conformation. Follow the storage recommendations precisely: store at -20°C/-80°C with aliquoting for multiple use, and keep working aliquots at 4°C for up to one week . Add glycerol (5-50% final concentration) after reconstitution to enhance stability .

How can researchers optimize experimental conditions for studying DDB_G0277605 in the context of Dictyostelium development?

Optimizing experimental conditions for studying DDB_G0277605 during Dictyostelium development requires:

  • Developmental Synchronization Strategies:

    • Precise starvation protocols with defined cell densities

    • pH-controlled non-nutrient agar

    • Uniform application of cells to development surfaces

    • Temperature and humidity control throughout the 24-hour cycle

  • Imaging Optimization:

    • Low-phototoxicity approaches for live-cell imaging

    • Time-lapse intervals appropriate for each developmental stage

    • Multi-position microscopy to capture population heterogeneity

    • Quantitative image analysis pipelines

  • Expression Control:

    • Native promoter constructs to maintain physiological expression

    • Inducible systems for stage-specific expression

    • Knock-in approaches for endogenous tagging

  • Environmental Variable Control:

    • Light conditions (Dictyostelium exhibits phototaxis)

    • Humidity (prevents drying during extended development)

    • Substrate stiffness (affects migration and differentiation)

    • Buffer composition (affects signal propagation)

When designing these experiments, leverage the distinctive features of Dictyostelium's 24-hour developmental cycle as depicted in Figure 1A . Document phenotypes at each key transition: aggregation, mound formation, slug migration, and culmination. Consider the potential stage-specific roles of DDB_G0277605, particularly if its expression varies throughout development.

What strategies can researchers employ to investigate potential interactions between DDB_G0277605 and known signaling pathways in Dictyostelium?

To investigate interactions between DDB_G0277605 and established signaling pathways:

  • Epistasis Analysis:

    • Generate double knockouts with key pathway components

    • Compare phenotypes of single vs. double mutants

    • Determine rescue capability with overexpression constructs

    • Analyze genetic interactions quantitatively

  • Biochemical Interaction Assessment:

    • Co-immunoprecipitation with known pathway components

    • Proximity labeling (BioID, APEX) to identify neighboring proteins

    • Phosphorylation status analysis during pathway activation

    • In vitro reconstitution of signaling complexes

  • Pathway-Specific Assays:

    • cAMP signaling: cAMP-induced Ca²⁺ flux, cAMP-dependent gene expression

    • Cytoskeletal regulation: F-actin polymerization, focal adhesion dynamics

    • Chemotaxis: micropipette assay, under-agarose chemotaxis

    • Cell differentiation: cell-type specific marker expression

  • System-Level Analysis:

    • Transcriptome profiling of knockout vs. wild-type during development

    • Phosphoproteomics during key developmental transitions

    • Computational network analysis to place DDB_G0277605 in known pathways

Given Dictyostelium's established role in studying conserved signaling pathways, focus on potential connections to G protein-coupled receptor signaling in chemotaxis (as reviewed by Kamimura and Ueda) , PIP₂ signaling (as studied by Janetopoulos and Fadil) , or mitochondrial activity (as investigated by Rosenbusch et al. in the context of Parkinson's disease genes) . These established research areas in Dictyostelium provide context for investigating DDB_G0277605's potential signaling roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.