Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0276999 (DDB_G0276999)

Shipped with Ice Packs
In Stock

Description

Functional and Biological Context

While DDB_G0276999 remains functionally uncharacterized, transmembrane proteins in Dictyostelium are broadly implicated in:

  • Signal transduction during phagocytosis and bacterial interactions .

  • Membrane trafficking and ion transport .

  • Environmental adaptation through transcriptional responses to bacterial exposure .

Notably, Dictyostelium transmembrane proteins often serve as drug targets or diagnostic biomarkers in other organisms , suggesting potential research utility for DDB_G0276999.

Research Gaps and Future Directions

Despite commercial availability, peer-reviewed studies directly investigating DDB_G0276999 are absent from current literature. Priorities for future research include:

  1. Mechanistic studies: Clarify its role in Dictyostelium membrane biology using knockout strains .

  2. Interactome profiling: Identify binding partners via yeast two-hybrid or co-IP assays .

  3. Pathway mapping: Link to known Dictyostelium pathways like phagocytosis or stress response .

Technical Considerations

  • Storage: Stable at -20°C/-80°C; avoid freeze-thaw cycles .

  • Reconstitution: Use deionized water with 5–50% glycerol for long-term stability .

  • Quality Control: Batch-specific SDS-PAGE and mass spectrometry data available upon request .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag if possible.
Synonyms
DDB_G0276999; Uncharacterized transmembrane protein DDB_G0276999
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-258
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0276999
Target Protein Sequence
MYRNILRKLKRQINTILKIYIFIKKHEHHLRKLFVIFQVIISIVLLSLSVTTNDHDHLFD SWYYFASHLILSLFGIFVFFKKSTNSKLLYLYVILLSGLLITASFSFFWYSGELNIIENT CISDQCNHDRAYYRKKTYKIIALIVVEGVALHPNLSWLIQVLKKERKLKQLNTINNTNDT AIRSPSLNNISGNNNNNINNNNINNSNNNINNTSYNNDYFNNHNIINNNKNNIYNNNNKI NSELQPPSILNKNSKPIE
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a model organism?

Dictyostelium discoideum is a social amoeba that has been established as a valuable model organism for studying numerous facets of eukaryotic cell biology. It offers insights into cell motility, cell adhesion, macropinocytosis, phagocytosis, host-pathogen interactions, and multicellular development . The organism has a unique life cycle that transitions from unicellular to multicellular forms under starvation conditions, providing a tractable system to investigate development in context .

The value of D. discoideum stems from its genetic tractability and the conservation of key molecular pathways found in higher eukaryotes. Genome analysis reveals it contains orthologs of several DNA repair pathway components otherwise limited to vertebrates, including the Fanconi Anemia DNA inter-strand crosslink and DNA strand break repair pathways . This conservation, coupled with the organism's haploid nature (34 Mb genome), makes genetic manipulation straightforward and phenotypic outcomes readily observable .

What are the basic characteristics of transmembrane proteins in D. discoideum?

Transmembrane proteins in D. discoideum, including DDB_G0276999, typically contain multiple transmembrane domains that anchor them within cellular membranes. Similar to other membrane proteins described in the literature, they often contain four transmembrane domains with both amino and carboxyl termini positioned intracellularly . These structural arrangements are critical for their function in cellular processes.

Hydrophilicity analyses can predict the topology of these transmembrane domains. As demonstrated with claudin family proteins, which share structural similarities with many transmembrane proteins, these predictions help determine the membrane-spanning regions and orientation of functional domains . For uncharacterized proteins like DDB_G0276999, such analyses provide initial insights into their potential functions and interactions with other cellular components.

How can I verify the expression of DDB_G0276999 in D. discoideum cells?

Verification of DDB_G0276999 expression can be accomplished through several complementary approaches:

  • Recombinant antibody detection: Utilizing recombinant antibodies (rAbs) specific to DDB_G0276999. A panel of such antibodies has been generated for D. discoideum antigens, providing useful reagents for labeling and characterization of proteins in this organism . Western blotting with these antibodies can confirm protein expression.

  • Epitope tagging: Creating fusion constructs with FLAG, HA, or other established tags enables detection using commercially available antibodies. This approach has been successfully employed for studying claudin family proteins and can be adapted for DDB_G0276999 .

  • Confocal microscopy: For subcellular localization, tagged proteins can be visualized using confocal microscopy. Computer-generated cross-sectional images can provide precise localization data, particularly for membrane proteins .

  • Transcriptomic analysis: Single-cell transcriptomics can reveal expression patterns and potentially identify conditions under which DDB_G0276999 is upregulated .

What expression systems work best for recombinant production of D. discoideum transmembrane proteins?

D. discoideum itself serves as an excellent host for recombinant protein expression, particularly for its own proteins. The organism efficiently secretes recombinant products when appropriate signal peptides are incorporated into expression constructs . For transmembrane proteins like DDB_G0276999, several approaches can be considered:

  • Native expression system: D. discoideum can express its own proteins with proper folding and post-translational modifications. Expression yields of up to 20 mg/L have been achieved for soluble proteins .

  • Modified constructs: For transmembrane proteins, creating soluble versions (by removing transmembrane domains) while retaining functional domains can increase expression and facilitate purification.

  • Expression stability: Expression of recombinant proteins in D. discoideum has been shown to be stable for at least one hundred generations in the absence of selection, making it suitable for long-term studies .

Expression SystemAdvantagesDisadvantagesTypical YieldBest Applications
D. discoideum hostNative post-translational modifications, Proper protein foldingLimited to laboratory scale1-20 mg/LFunctional studies, Structural analysis
Truncated/soluble constructsHigher yield, Easier purificationMay lose some functional properties5-20 mg/LBinding studies, Antibody production
Tagged constructsEasy detection and purificationTag may interfere with function1-10 mg/LLocalization studies, Interaction studies

How can I optimize protein yield when expressing DDB_G0276999 in D. discoideum?

Optimization of DDB_G0276999 expression requires attention to several parameters:

  • Promoter selection: Using strong, constitutive promoters or inducible systems can significantly impact yield. The actin promoter is commonly used for high-level expression.

  • Codon optimization: Although expressing a native protein, codon usage can still be optimized for the highest level of expression.

  • Signal sequence optimization: For secreted versions, testing different signal peptides can enhance secretion efficiency. D. discoideum correctly processes signal peptides from its recombinant proteins .

  • Culture conditions: Optimizing growth media, temperature, and harvesting time can significantly improve yields. Standard peptone-based growth medium has been used successfully for recombinant protein production .

  • Purification strategy: For membrane proteins, selecting appropriate detergents for solubilization is critical. A staged approach beginning with gentle detergents (e.g., digitonin, DDM) can help maintain protein structure and function.

What are the challenges in purifying transmembrane proteins like DDB_G0276999?

Purification of transmembrane proteins presents several unique challenges:

  • Membrane extraction: The primary challenge involves efficiently extracting the protein from membranes while maintaining native conformation. This requires careful selection of detergents and solubilization conditions.

  • Protein stability: Once removed from their membrane environment, transmembrane proteins often become unstable. Addition of lipids or use of nanodiscs/liposomes during purification can maintain stability.

  • Aggregation: Transmembrane proteins have a tendency to aggregate during concentration steps. This can be mitigated by including glycerol or specific detergents in buffers.

  • Functional assessment: Confirming that purified transmembrane proteins retain their native function is challenging. Developing activity assays specific to DDB_G0276999 will be important once its function is better characterized.

  • Yield limitations: Due to these challenges, yields are typically lower than for soluble proteins. Expression strategies that create soluble domains of the protein may be considered as alternatives for certain applications.

How can I use D. discoideum to study the function of uncharacterized transmembrane proteins like DDB_G0276999?

Studying uncharacterized transmembrane proteins in D. discoideum can leverage several advanced approaches:

  • Gene disruption/knockout: The haploid nature of D. discoideum makes gene disruption straightforward. Phenotypic analysis of DDB_G0276999 knockout cells can provide insights into its function .

  • Developmental studies: Since D. discoideum undergoes a well-characterized developmental program, examining how DDB_G0276999 disruption affects this process can reveal its role in differentiation or morphogenesis .

  • Protein localization: Fluorescently tagged versions of DDB_G0276999 can reveal subcellular localization patterns during growth and development, providing functional clues .

  • Interaction studies: Techniques such as immunoprecipitation followed by mass spectrometry can identify binding partners of DDB_G0276999, establishing its place in protein networks.

  • Response to environmental challenges: Exposing cells to various stressors (pH changes, osmotic stress, nutrient limitation) and monitoring changes in DDB_G0276999 expression or localization can suggest functional roles .

What techniques are recommended for studying protein-protein interactions involving DDB_G0276999?

Several approaches are particularly suited for studying protein-protein interactions involving transmembrane proteins in D. discoideum:

  • Co-immunoprecipitation with recombinant antibodies: The availability of recombinant antibodies for D. discoideum proteins facilitates co-IP studies to identify interaction partners .

  • Proximity labeling techniques: BioID or APEX2 fusion proteins can identify proximal proteins in living cells, capturing even transient interactions.

  • Split-protein complementation assays: Methods like bimolecular fluorescence complementation (BiFC) can visualize interactions in living cells.

  • Chemical crosslinking followed by mass spectrometry: This approach can capture interactions between membrane proteins that might be disrupted during standard purification.

  • Yeast two-hybrid membrane system: Specialized Y2H systems for membrane proteins can be employed to screen for potential interactors.

TechniqueAdvantagesLimitationsBest For
Co-immunoprecipitationDetects native complexesMay lose weak interactionsStable interactions
Proximity labelingIn vivo labeling, captures transient interactionsPotential false positives from proximity aloneMapping interaction neighborhoods
BiFCDirect visualization in living cellsIrreversible complex formationConfirming predicted interactions
Crosslinking-MSPreserves weak interactionsComplex data analysisComprehensive interaction mapping

How does the transmembrane structure of DDB_G0276999 affect experimental design considerations?

The transmembrane nature of DDB_G0276999 imposes specific considerations on experimental design:

  • Membrane topology prediction: Computational analysis should be performed to predict transmembrane domains and orientation within the membrane. This information guides the design of functional constructs .

  • Domain-specific constructs: Creating constructs that express specific domains (e.g., extracellular loops, cytoplasmic regions) can facilitate functional studies without the challenges of full-length membrane protein expression.

  • Detergent selection: For experiments requiring protein extraction, detergent selection is critical. Different detergents may preferentially extract proteins from different membrane compartments or preserve different protein-protein interactions.

  • Fluorescent protein fusion placement: When creating fluorescent protein fusions, the tag position (N-terminal, C-terminal, or internal) must be carefully considered to avoid disrupting membrane insertion or protein function.

  • Localization controls: Including well-characterized membrane compartment markers in localization studies is essential for precise determination of DDB_G0276999's subcellular distribution.

What developmental phenotypes should I look for when studying DDB_G0276999 function?

D. discoideum's unique developmental cycle provides multiple phenotypic readouts for functional studies:

  • Aggregation efficiency: Changes in the timing or pattern of aggregation upon starvation can indicate defects in cell motility, chemotaxis, or cell-cell adhesion .

  • Morphological development: Abnormalities in mound formation, slug migration, or fruiting body structure may reveal roles in differentiation or morphogenesis .

  • Cell sorting patterns: During development, cells with DNA damage are frequently excluded from the spore differentiation pathway . If DDB_G0276999 affects genome stability, similar sorting patterns might be observed.

  • Spore formation and viability: Defects in spore formation, maturation, or germination could indicate roles in cell differentiation or stress resistance .

  • Cell-type proportions: Changes in the ratio of stalk to spore cells might suggest roles in cell fate determination or differentiation signaling.

How can I design experiments to investigate DDB_G0276999's potential role in membrane trafficking?

To investigate potential roles in membrane trafficking:

  • Colocalization studies: Use fluorescently tagged DDB_G0276999 along with markers for different membrane compartments (endoplasmic reticulum, Golgi, endosomes, plasma membrane) to determine its distribution .

  • Trafficking dynamics: Employ live-cell imaging with photoactivatable or photoconvertible fluorescent protein fusions to track protein movement between compartments.

  • Endocytosis and phagocytosis assays: Measure uptake of fluorescent markers (e.g., fluorescent dextran for macropinocytosis, fluorescent beads for phagocytosis) in wild-type versus DDB_G0276999-disrupted cells.

  • Recycling assays: Quantify the rate of membrane protein recycling to determine if DDB_G0276999 affects endocytic recycling pathways.

  • Secretion efficiency: Measure secretion rates of model proteins in the presence and absence of DDB_G0276999.

What approaches can help determine if DDB_G0276999 functions in cell adhesion or multicellular development?

Several approaches can address potential roles in adhesion and development:

  • Cell-substrate adhesion assays: Measure the strength of cell attachment to various substrates in the presence and absence of DDB_G0276999.

  • Cell-cell adhesion tests: Quantify the cohesiveness of cell aggregates and their resistance to mechanical disruption.

  • Development under submerged conditions: This modified developmental assay can reveal subtle phenotypes in early development and cell polarization.

  • Chimeric development: Mix DDB_G0276999-disrupted cells (fluorescently labeled) with wild-type cells to assess cell sorting and participation in multicellular structures .

  • Time-lapse imaging: Record the developmental process to identify specific stages where abnormalities might occur in mutant cells.

How should I organize and analyze data from DDB_G0276999 functional studies?

  • Experimental design and data tables: Structure experiments with clear independent and dependent variables. For each experiment, create data tables that clearly identify the variables, include multiple trials, and calculate derived quantities such as averages .

Study TypeIndependent VariableDependent VariableNumber of ReplicatesStatistical Test
LocalizationCell type/conditionFluorescence distribution≥3Correlation analysis
Knockout phenotypeGenotypeDevelopmental timing≥3t-test/ANOVA
Protein interactionBait/prey combinationInteraction strength≥3Multiple comparison test
Expression profilingDevelopment stageExpression level≥3Time series analysis
  • Standardized nomenclature: Use consistent terminology for cell lines, constructs, and experimental conditions throughout your studies.

  • Image analysis standardization: For microscopy data, establish consistent acquisition parameters and quantification methods to ensure comparability between experiments.

  • Statistical approach: Apply appropriate statistical tests based on data distribution and experimental design. For developmental studies, time-series analysis may be necessary.

  • Data visualization: Create visualization formats that highlight the key findings while accurately representing variability in the data.

What are common pitfalls when working with transmembrane proteins in D. discoideum and how can I avoid them?

Common challenges and their solutions include:

  • Protein mislocalization due to overexpression: Use inducible expression systems or knock-in approaches to maintain physiological expression levels.

  • Functional disruption by tags: Test multiple tag positions (N-terminal, C-terminal, internal loops) and different tag types to minimize functional interference.

  • Poor antibody specificity: The recombinant antibody toolbox for D. discoideum provides validated reagents that can overcome specificity issues commonly encountered with commercial antibodies .

  • Extraction efficiency variations: Standardize membrane preparation and solubilization protocols, including careful selection of detergents appropriate for transmembrane proteins.

  • Phenotypic misinterpretation: Include appropriate controls and rescue experiments to confirm that observed phenotypes are specifically due to DDB_G0276999 disruption rather than off-target effects.

How can contradictory data about DDB_G0276999 function be reconciled?

When faced with contradictory results:

  • Context dependency: Consider whether different experimental conditions might explain divergent outcomes. D. discoideum cells in different growth phases or developmental stages may show different protein functions .

  • Technical variables: Examine differences in methodologies, including protein expression levels, tag interference, or assay sensitivity.

  • Functional redundancy: Investigate potential compensatory mechanisms or redundant proteins that might mask phenotypes in some experimental setups.

  • Multiple functions: Many transmembrane proteins perform different functions depending on subcellular localization or interaction partners. DDB_G0276999 may have context-dependent roles.

  • Integrated approach: Combine multiple independent techniques (genetic, biochemical, cell biological) to build a comprehensive understanding that reconciles seemingly contradictory observations.

What emerging technologies might advance our understanding of proteins like DDB_G0276999?

Several cutting-edge approaches hold promise:

  • Cryo-electron microscopy: For structural determination of membrane proteins without crystallization.

  • Genome editing with CRISPR-Cas9: For precise modification of endogenous genes to study function in physiological contexts.

  • Single-cell transcriptomics: To identify conditions and cell populations where DDB_G0276999 is differentially expressed .

  • Nanobody development: Single-domain antibodies may provide superior tools for detection and functional modulation of transmembrane proteins.

  • Microfluidic approaches: For high-throughput phenotypic screening of cell behavior under controlled chemical gradients or mechanical environments.

How can findings about DDB_G0276999 in D. discoideum be translated to human health research?

Translational potential includes:

  • Conserved protein families: Identify human homologs or proteins with similar domain structures that might share functions with DDB_G0276999.

  • Pathway conservation: Even without direct homologs, pathways involving DDB_G0276999 may be conserved in humans and relevant to disease processes.

  • Drug discovery applications: If DDB_G0276999 is involved in conserved cellular processes like membrane trafficking or cell adhesion, it may serve as a model for therapeutic target discovery.

  • Development of research tools: Methods optimized for studying this transmembrane protein may be applicable to challenging human membrane proteins .

  • Disease modeling: If human homologs are identified, D. discoideum could serve as a simple model system for studying disease-associated variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.