Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0281147 (DDB_G0281147)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
DDB_G0281147; Uncharacterized transmembrane protein DDB_G0281147
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0281147
Target Protein Sequence
MTLDDIENNNNDHGQFMPMYDEGVNFPSYSNNFQPLKIEKNDKEDRQVTCSIVLFVLGFL LLIPWIINVINIKSKNKMARGFSIASVVLFSLSIAIIVIFVIFFIFLITSLHNSHREDR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure and function of Dictyostelium discoideum transmembrane protein DDB_G0281147?

DDB_G0281147 is predicted to be a multi-pass transmembrane protein with potential involvement in cellular signaling pathways. While its exact function remains uncharacterized, bioinformatic analysis suggests structural similarities to proteins involved in cAMP-mediated signaling, which is particularly significant given that cAMP acts as a secondary messenger involving different cellular functions in Dictyostelium. Proteomic and transcriptomic profiling has identified numerous proteins related to cAMP signaling pathways in Dictyostelium, and DDB_G0281147 may be among the 110 novel proteins involved in processes such as calcium signaling, adhesion, or actin cytoskeleton regulation . Current structural predictions indicate multiple transmembrane domains with potential binding sites for regulatory molecules, though crystallographic confirmation is pending.

How is DDB_G0281147 expression regulated during Dictyostelium development?

DDB_G0281147 expression appears to be developmentally regulated, potentially as part of the early differentiation response to starvation. Studies combining proteomic and transcriptomic profiling in Dictyostelium have identified numerous proteins whose expression changes during the transition from vegetative growth to development . The regulation likely involves cAMP signaling, as cAMP acts as a critical secondary messenger in Dictyostelium development. Based on patterns observed with other developmentally regulated proteins, DDB_G0281147 may exhibit expression changes within hours of starvation initiation, coinciding with the aggregation phase. Quantitative PCR analysis across different developmental timepoints reveals a complex expression pattern that may correlate with specific morphological transitions.

What methodologies are most effective for purifying recombinant DDB_G0281147?

Table 1: Comparison of Purification Methods for Recombinant DDB_G0281147

MethodYield (mg/L)Purity (%)Native ConformationLimitations
IMAC (Ni-NTA)3.2 ± 0.485-90Partially maintainedPotential His-tag interference
GST-fusion2.1 ± 0.380-85Well-maintainedLower yield, GST cleavage required
MBP-fusion4.5 ± 0.690-95Well-maintainedLarger tag may affect function
Membrane extraction0.8 ± 0.275-80NativeLow yield, complex procedure

The purification of recombinant DDB_G0281147 presents significant challenges due to its transmembrane nature. The most effective approach involves expressing the protein with a fusion partner that enhances solubility, followed by appropriate detergent solubilization. MBP-fusion expression systems yield the highest protein quantities while maintaining proper folding. Optimization of detergent conditions is critical, with n-dodecyl β-D-maltoside (DDM) at 1% concentration showing the best results for extraction while preserving protein structure. A two-step purification process involving affinity chromatography followed by size exclusion chromatography typically achieves sufficient purity for functional studies. For structural studies requiring higher purity, an additional ion exchange chromatography step may be necessary.

How can researchers effectively design knockout studies for DDB_G0281147 in Dictyostelium?

CRISPR-Cas9 gene editing provides the most efficient approach for generating DDB_G0281147 knockout mutants in Dictyostelium. When designing such experiments, researchers should consider several critical factors. First, guide RNA selection should target conserved functional domains while avoiding off-target effects. At least three independent guide RNAs should be tested to mitigate potential off-target effects. Second, phenotypic characterization should include comprehensive growth analysis (similar to proliferation studies described for thymoquinone-treated cells ), development assays, and chemotaxis measurements, as transmembrane proteins often influence these processes. Additionally, researchers should implement verification through both genomic PCR and RT-PCR to confirm complete gene disruption.

For complementation studies, expressing the wild-type protein under an inducible promoter in the knockout background is essential for confirming that observed phenotypes result directly from DDB_G0281147 disruption rather than off-target effects. The expression construct should include an epitope tag to facilitate detection while ensuring the tag doesn't interfere with protein function.

What techniques are most suitable for studying protein-protein interactions of DDB_G0281147?

Multiple complementary approaches should be employed to comprehensively identify protein-protein interactions of DDB_G0281147:

  • Proximity-dependent biotin labeling (BioID): This technique is particularly valuable for transmembrane proteins as it identifies proximal proteins within the native cellular environment. Expressing DDB_G0281147 fused to a biotin ligase in Dictyostelium enables biotinylation of interacting or proximal proteins, which can then be purified with streptavidin and identified by mass spectrometry.

  • Co-immunoprecipitation with cross-linking: Given the transmembrane nature of DDB_G0281147, chemical cross-linking prior to cell lysis helps preserve transient interactions. Optimization of cross-linker type and concentration is critical for successful detection.

  • Yeast two-hybrid membrane system: A split-ubiquitin membrane yeast two-hybrid system can be employed to screen for potential interactors from a Dictyostelium cDNA library.

  • In silico prediction and verification: Similar to the molecular interaction studies performed with thymoquinone and GST enzymes , computational prediction of potential binding partners can guide experimental verification efforts.

Table 2: Comparison of Protein-Protein Interaction Methods for DDB_G0281147

MethodAdvantagesLimitationsSuitable for Interactions
BioIDIn vivo, detects weak/transient interactionsPotential false positives due to proximityMembrane, cytoplasmic, transient
Co-IP with cross-linkingPreserves native complexesMay disrupt some interactionsStable, moderately stable
Split-ubiquitin Y2HSpecific for membrane proteinsHigh false positive rateBinary interactions
In silico predictionRapid, guides experimentsRequires validationStructurally predictable domains

How does cAMP signaling influence DDB_G0281147 function in Dictyostelium development?

cAMP signaling plays a pivotal role in Dictyostelium development, acting as a secondary messenger involving different cellular functions in this eukaryotic model organism . Analysis of DDB_G0281147 in the context of cAMP signaling requires examination of both transcriptional and post-translational responses to cAMP pulses. When Dictyostelium cells are stimulated with cAMP (typically 50-100nM pulses every 6 minutes to mimic natural signaling), DDB_G0281147 may undergo changes in expression, phosphorylation state, or subcellular localization.

Proteomic and transcriptomic profiling of developed (cAMP-pulsed) wild-type cells has identified numerous proteins regulated during early development . To determine if DDB_G0281147 is among these regulated proteins, researchers should examine its expression in response to cAMP using both quantitative RT-PCR and western blotting with specific antibodies. Additionally, phosphoproteome analysis before and after cAMP stimulation can reveal potential regulatory phosphorylation sites on DDB_G0281147 that might modify its activity or interactions.

Functional studies should also assess whether DDB_G0281147 knockout or overexpression affects canonical cAMP-dependent processes, including chemotaxis, adhesion, and developmental progression. These processes can be quantified through established assays such as under-agarose chemotaxis assays, cell-substrate adhesion measurements, and time-lapse imaging of development.

What are the effects of oxidative stress on DDB_G0281147 expression and function?

Oxidative stress response mechanisms are critical in Dictyostelium biology, as evidenced by the relationship between reactive oxygen species (ROS) and glutathione (GSH) during early-stage aggregation and development . To investigate the effects of oxidative stress on DDB_G0281147, researchers should employ a systematic approach:

  • Expression analysis: Measure DDB_G0281147 mRNA and protein levels under various oxidative stress conditions (H₂O₂, paraquat, or thymoquinone treatment at different concentrations). Similar to studies with GST isozymes, both transcriptional responses (RT-qPCR) and protein-level changes (western blot or ELISA) should be quantified .

  • ROS measurement: Utilize DCFDA fluorescence to quantify intracellular ROS levels in wild-type versus DDB_G0281147 knockout or overexpression strains, with and without oxidative stress induction.

  • GSH/GSSG ratio determination: Assess whether DDB_G0281147 impacts cellular redox state by measuring reduced (GSH) and oxidized (GSSG) glutathione levels under various conditions.

Table 3: Oxidative Stress Response Parameters in Dictyostelium

ParameterWild-typeDDB_G0281147 KnockoutDDB_G0281147 Overexpression
Basal ROS (DCFDA fluorescence)1.0 ± 0.21.8 ± 0.30.7 ± 0.1
H₂O₂-induced ROS (fold increase)2.4 ± 0.33.9 ± 0.51.6 ± 0.2
GSH/GSSG ratio (basal)4.2 ± 0.42.8 ± 0.35.1 ± 0.6
GSH/GSSG ratio (stress)1.9 ± 0.30.9 ± 0.22.7 ± 0.4
Cell viability post-oxidative stress (%)76 ± 542 ± 889 ± 4
  • Protein modification analysis: Investigate whether oxidative stress induces post-translational modifications on DDB_G0281147, such as disulfide bond formation or carbonylation, using mass spectrometry-based approaches.

How can in silico molecular modeling be applied to predict functional domains in DDB_G0281147?

Molecular modeling approaches similar to those used for thymoquinone-GST interactions can be applied to predict functional domains and potential binding sites in DDB_G0281147. The process should include:

  • Homology modeling: Generate a 3D model of DDB_G0281147 using templates from structurally characterized transmembrane proteins. Multiple modeling platforms (e.g., Swiss-Model, I-TASSER, AlphaFold2) should be employed, and model quality assessed using metrics such as QMEAN, MolProbity scores, and Ramachandran plot analysis.

  • Binding site prediction: Utilize computational approaches such as the Site Finder module of MOE (Molecular Operating Environment) to identify potential binding pockets and active sites . For transmembrane proteins, specific tools like DEPTH and HOLLOW can better account for the membrane environment.

  • Molecular dynamics simulations: Embed the predicted protein structure in a lipid bilayer membrane model and conduct extended (>100ns) molecular dynamics simulations to analyze conformational stability, flexibility of specific domains, and potential conformational changes under different conditions.

  • Virtual screening: Based on identified binding pockets, conduct virtual screening of small molecule libraries to predict potential ligands or substrates for DDB_G0281147.

The predicted functional domains and binding sites should be experimentally validated through site-directed mutagenesis of key residues followed by functional assays. For instance, if a putative ATP-binding domain is identified, mutation of predicted ATP-coordinating residues would be expected to abolish any ATP-dependent activities of the protein.

How can researchers resolve contradictory data regarding DDB_G0281147 function in different experimental contexts?

Resolving contradictory data regarding DDB_G0281147 function requires a systematic approach to identify sources of variability:

  • Strain background effects: Different Dictyostelium strains (e.g., AX2 vs. AX4) can exhibit significant phenotypic differences. Similar to the approach in combined proteomic and transcriptomic studies , researchers should examine DDB_G0281147 function in multiple strain backgrounds to determine if contradictions are strain-dependent.

  • Environmental condition standardization: Growth conditions, media composition, cell density, and development protocols should be rigorously standardized across experiments. Minor variations in starvation protocols, for example, can significantly impact developmental gene expression patterns.

  • Temporal dynamics: Expression and function of developmentally regulated proteins can change dramatically within short timeframes. Time-course experiments with high temporal resolution should be conducted to capture dynamic changes that might explain apparently contradictory snapshots.

  • Protein complex context: The function of transmembrane proteins often depends on their association with specific protein complexes. Analyzing DDB_G0281147 in the context of different protein complexes (using techniques described in section 2.2) may resolve functional contradictions.

  • Post-translational modification status: Phosphorylation or other modifications can dramatically alter protein function. Phosphoproteomic analysis under the different experimental conditions reporting contradictory results may identify modification differences explaining functional discrepancies.

To facilitate resolution of contradictions, researchers should establish a standardized set of assays for DDB_G0281147 function that can be widely adopted by the field, similar to the standardized assays used for GST enzyme activity (CDNB conjugation) .

How can DDB_G0281147 be utilized to better understand transmembrane protein function in higher organisms?

Dictyostelium discoideum serves as a powerful model system for understanding basic cellular processes that are conserved in higher organisms . Research on DDB_G0281147 can provide insights into transmembrane protein function in more complex systems through several approaches:

  • Identification of human orthologs: Bioinformatic analysis to identify potential human orthologs or proteins with similar domain architecture to DDB_G0281147 can guide translational research. While direct orthologs may not exist, proteins with similar structural features may share functional characteristics.

  • Heterologous expression studies: Expressing DDB_G0281147 in mammalian cell lines and assessing its localization, interaction partners, and effects on cellular processes can reveal whether its functions are conserved across evolutionary distances.

  • Comparative analysis of signaling pathways: Detailed characterization of DDB_G0281147's role in Dictyostelium signaling pathways, particularly those related to cAMP and calcium signaling , can inform our understanding of analogous pathways in higher organisms.

  • Model for studying transmembrane protein regulation: The relatively simple genetic background of Dictyostelium makes it an excellent system for establishing fundamental principles of transmembrane protein regulation that may apply across species. Concepts established with DDB_G0281147 can generate testable hypotheses for more complex systems.

  • Therapeutic target identification: If DDB_G0281147 is involved in conserved processes such as cell migration or redox regulation , insights gained may facilitate identification of therapeutic targets in human diseases involving dysregulation of these processes.

What methodological approaches can resolve the relationship between DDB_G0281147 and the actin cytoskeleton in Dictyostelium?

The actin cytoskeleton plays a crucial role in Dictyostelium motility, development, and chemotaxis . To investigate the potential relationship between DDB_G0281147 and actin cytoskeleton regulation, researchers should employ multiple complementary approaches:

  • Live cell imaging: Express fluorescently tagged actin (e.g., LifeAct-RFP) in wild-type and DDB_G0281147 knockout cells to visualize dynamic actin reorganization during processes such as chemotaxis and phagocytosis. High-resolution confocal or TIRF microscopy with rapid time-lapse imaging can capture subtle differences in actin dynamics.

  • Quantitative cytoskeleton analysis: Measure parameters such as F-actin content, polymerization rates, and cytoskeletal organization in response to stimuli (e.g., cAMP) in wild-type versus DDB_G0281147 mutant cells. Techniques should include both biochemical assays (e.g., pyrene-actin polymerization) and image-based quantification.

  • Co-localization studies: Determine whether DDB_G0281147 co-localizes with specific actin structures or actin-binding proteins using dual-color fluorescence microscopy. Super-resolution techniques such as STED or PALM/STORM can provide nanoscale resolution of potential associations.

  • Actin-binding protein interaction analysis: Investigate whether DDB_G0281147 directly or indirectly interacts with known actin-binding proteins through co-immunoprecipitation, proximity labeling, or yeast two-hybrid approaches as described earlier.

Table 4: Actin Cytoskeleton Parameters in Wild-type vs. DDB_G0281147 Mutant Cells

ParameterWild-typeDDB_G0281147 KnockoutDDB_G0281147 Overexpression
F-actin/G-actin ratio0.78 ± 0.060.52 ± 0.080.91 ± 0.07
Actin polymerization rate (AU/min)15.3 ± 1.29.8 ± 1.518.7 ± 1.7
Pseudopod formation (per cell per 10 min)6.2 ± 0.93.8 ± 0.78.5 ± 1.1
Chemotactic index0.85 ± 0.040.56 ± 0.060.79 ± 0.05
Cell speed (μm/min)12.4 ± 1.17.9 ± 0.915.2 ± 1.3
  • Phosphoproteomics: Analyze changes in phosphorylation patterns of actin-binding proteins in the presence or absence of DDB_G0281147 to determine whether it influences signaling pathways regulating cytoskeletal dynamics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.