Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0281339 (DDB_G0281339)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Dictyostelium discoideum Uncharacterized Transmembrane Protein DDB_G0281339 (UniProt ID: Q54U35) is a bacterially expressed protein derived from the social amoeba D. discoideum. This protein, produced in Escherichia coli with an N-terminal His tag, represents a full-length (1-224 amino acids) transmembrane protein of unknown function . Despite its uncharacterized role, its structural features and expression systems have made it a subject of interest for proteomic and functional studies in microbial biology and cell signaling .

Expression and Purification

The protein is produced via recombinant DNA technology in E. coli, followed by affinity chromatography using a His tag . Critical production parameters include:

ParameterSpecification
Host SystemE. coli
TagN-terminal His tag
Purity>90% (verified by SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended for long-term storage

Lyophilized formulations ensure stability at -20°C/-80°C, with strict avoidance of repeated freeze-thaw cycles .

Functional and Research Implications

While DDB_G0281339’s exact biological role remains undefined, its structural homology to bacteriolytic proteins (e.g., BadA/B/C) suggests potential involvement in D. discoideum’s antimicrobial defenses . Key findings from related studies include:

  • pH-Dependent Activity: D. discoideum lysosomal proteins often function optimally at acidic pH (~2.5), mimicking phagosomal conditions .

  • Genetic Links: Mutants lacking kil1 (a sulfotransferase critical for bacterial killing) show reduced bacteriolytic activity, indirectly implicating DUF3430-domain proteins in microbial lysis .

  • Proteomic Utility: Mass spectrometry workflows for D. discoideum proteins have identified ~3,500 intracellular targets, enabling high-throughput analysis of uncharacterized proteins like DDB_G0281339 .

Applications in Research

  • Transmembrane Protein Studies: Used to investigate membrane protein folding and stability under acidic conditions .

  • Host-Pathogen Interaction Models: D. discoideum serves as a proxy for studying phagocytosis and intracellular bacterial killing mechanisms .

  • Proteomic Benchmarking: Included in proteomic datasets to validate extraction and analysis protocols .

Future Directions

Further studies are needed to:

  1. Elucidate DDB_G0281339’s interaction partners via co-immunoprecipitation or yeast two-hybrid screens.

  2. Characterize its enzymatic or structural role in D. discoideum phagosomes.

  3. Explore its potential as a tool for synthetic biology or antimicrobial peptide design.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
DDB_G0281339; Uncharacterized transmembrane protein DDB_G0281339
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0281339
Target Protein Sequence
MMHALGDLFKPEEKEIKMDRDKCSGACVAIWTWKTIVRLICLIAGGVQVFMGGYIFYSIS FTKDHSVQNYLSLSVVGFYACLTGLLILFAETRTRWTRRAVKVFVFLCNGLSRGIIYILI GAIDQSPIPFKFLNIITSMHIGLVCIAGGVVSIIEFLITYRRNRARLNQAIANHQQQAKG TELYDLFEREDFNNPEDAAAYDLEKGKDPNYIHQDLEMQPVQEA
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable as a research model?

Dictyostelium discoideum is a social amoeba with significant research importance as a model organism. It represents an early branch in the Eukaryotic Tree of Life that diverged after the split between animals, plants, and fungi, with Dictyostelium and other amoebae positioned more closely related to animals . The organism has a fully sequenced 34 MB genome (completed in 2005) that is maintained in dictyBase, the model organism database dedicated to Dictyostelium .

The value of Dictyostelium in research stems from several key attributes:

  • Many Dictyostelium proteins are more similar to human orthologs than those found in Saccharomyces cerevisiae, making it relevant for comparative studies with human proteins

  • It has been successfully used to understand mechanisms of action for medically important drugs, including cisplatin (used to treat various cancers) and lithium and valproic acid (used to treat depressive disorders)

  • The relatively compact genome encodes approximately 13,573 genes, comparable to the gene count in Drosophila

  • The organism's unique biology provides insights into processes not characterized in other organisms

These characteristics make Dictyostelium an excellent model for studying conserved cellular processes and for exploring the functions of uncharacterized proteins, including transmembrane proteins like DDB_G0281339.

What are the known structural characteristics of DDB_G0281339?

DDB_G0281339 is a full-length (224 amino acid) uncharacterized transmembrane protein from Dictyostelium discoideum. Current structural information includes:

CharacteristicDetails
Protein Length224 amino acids (full length)
UniProt IDQ54U35
TagsN-terminal His tag (in recombinant form)
Expression SystemE. coli
Amino Acid SequenceMMHALGDLFKPEEKEIKMDRDKCSGACVAIWTWKTIVRLICLIAGGVQVFMGGYIFYSIS FTKDHSVQNYLSLSVVGFYACLTGLLILFAETRTRWTRRAVKVFVFLCNGLSRGIIYILI GAIDQSPIPFKFLNIITSMHIGLVCIAGGVVSIIEFLITYRRNRARLNQAIANHQQQAKG TELYDLFEREDFNNPEDAAAYDLEKGKDPNYIHQDLEMQPVQEA

The protein's designation as a transmembrane protein suggests it contains hydrophobic domains that span the cellular membrane, though the exact number of transmembrane domains and their positions would require further bioinformatic analysis or experimental determination.

How should researchers handle and store recombinant DDB_G0281339 protein for optimal stability?

Based on manufacturer recommendations, researchers should follow these protocols for handling and storage:

  • Initial handling: Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitution method:

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (manufacturer's default is 50%)

    • Aliquot for long-term storage to avoid repeated freeze-thaw cycles

  • Storage conditions:

    • Store at -20°C/-80°C upon receipt

    • For working aliquots, store at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this can degrade protein quality

  • Buffer composition: The lyophilized protein is provided in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Following these recommendations will help ensure experimental reproducibility and maintain protein integrity throughout your research project.

What experimental approaches are recommended for functionally characterizing uncharacterized transmembrane proteins like DDB_G0281339?

Functional characterization of uncharacterized transmembrane proteins requires multiple complementary approaches:

ApproachMethodologyExpected Insights
Subcellular LocalizationFluorescent tagging (GFP fusion) or immunofluorescence using antibodies against the His tagDetermine which cellular membrane(s) the protein resides in
Protein-Protein InteractionsCo-immunoprecipitation using the His tag; Yeast two-hybrid assays; Proximity labeling approachesIdentify binding partners that may suggest function
Gene DisruptionCRISPR-Cas9 knockout in Dictyostelium; RNAi knockdownObserve phenotypic consequences of protein absence
Structure PredictionIn silico modeling using AlphaFold or similar toolsPredict structural domains and potential binding sites
Comparative GenomicsAlignment with proteins of known function across speciesIdentify conserved domains that suggest function

These approaches should be conducted systematically, beginning with bioinformatic analyses and localization studies, followed by interaction studies and functional assays. Start with the Dictyostelium system since it represents the native environment for this protein, then consider heterologous expression systems for specialized assays.

For transmembrane proteins specifically, consider lipid bilayer composition effects on protein function, as membrane environment can dramatically affect protein behavior and interaction capabilities.

How can researchers use DDB_G0281339 in comparative genomics studies with human proteins?

DDB_G0281339 offers valuable opportunities for comparative genomics research with human proteins due to the evolutionary positioning of Dictyostelium. To effectively use this protein in comparative studies:

  • Homology identification: Use BLAST, HMM profiles, and other sequence comparison tools to identify potential human homologs. Dictyostelium proteins are often more similar to human orthologs than those of Saccharomyces cerevisiae , making them valuable for identifying conserved functions.

  • Domain analysis: Compare conserved domains between DDB_G0281339 and human proteins to identify functional motifs that may predict protein function. Focus on transmembrane domains and any other recognizable structural features.

  • Heterologous expression: Express DDB_G0281339 in human cell lines and assess its localization and function. Likewise, express human homologs in Dictyostelium knockout strains to test for functional complementation.

  • Evolutionary analysis: Construct phylogenetic trees including DDB_G0281339, its human homologs, and related proteins from other model organisms to understand the evolutionary history and potential functional divergence.

  • Disease relevance assessment: If human homologs are identified, investigate whether they are implicated in disease states. Dictyostelium has previously been used to investigate mechanisms of action for cancer drugs like cisplatin and psychiatric medications like lithium .

These approaches can reveal conserved functions across evolutionary distances and potentially identify novel roles for uncharacterized human proteins based on findings in the Dictyostelium system.

What are the potential challenges in expressing and purifying DDB_G0281339 and how can researchers address them?

Transmembrane proteins present several challenges for recombinant expression and purification. For DDB_G0281339, researchers should anticipate and address the following:

  • Protein aggregation and inclusion body formation:

    • Challenge: Hydrophobic transmembrane domains often cause aggregation in E. coli

    • Solution: Optimize expression conditions (lower temperature, reduced induction), use solubility-enhancing fusion partners, or deliberately express in inclusion bodies followed by refolding

  • Proper membrane insertion:

    • Challenge: Ensuring correct folding and membrane insertion in heterologous systems

    • Solution: Consider membrane-mimicking environments during purification (detergents, nanodiscs, liposomes)

  • Low expression yields:

    • Challenge: Transmembrane proteins often express at lower levels than soluble proteins

    • Solution: Use specialized expression strains (e.g., C41/C43 for membrane proteins), optimize codon usage, or switch to eukaryotic expression systems

  • Purification complications:

    • Challenge: Maintaining protein stability during solubilization and purification

    • Solution: Screen multiple detergents or detergent-free systems (SMALPs, nanodiscs), optimize buffer conditions, and include stabilizing agents

  • Verification of proper folding:

    • Challenge: Confirming that the purified protein maintains native structure

    • Solution: Employ circular dichroism, thermal shift assays, and functional assays where possible

The current recombinant DDB_G0281339 is expressed in E. coli with an N-terminal His tag , which facilitates purification but may not represent optimal conditions for all research applications. Consider adapting expression systems based on your specific experimental needs.

What protein interaction studies would be most appropriate for identifying DDB_G0281339 binding partners?

When investigating protein interactions for uncharacterized transmembrane proteins like DDB_G0281339, consider these methodological approaches:

  • In-membrane techniques:

    • Membrane yeast two-hybrid systems (specifically designed for transmembrane proteins)

    • Split-ubiquitin assays (ideal for membrane protein interactions)

    • FRET/BRET approaches with fluorescent protein fusions

  • Proximity labeling methods:

    • BioID or TurboID fusion proteins to biotinylate nearby proteins

    • APEX2 fusion proteins for proximity-based labeling

    • These approaches are particularly valuable for transmembrane proteins as they capture interactions in their native membrane environment

  • Co-immunoprecipitation with crosslinking:

    • Use membrane-permeable crosslinkers to stabilize transient interactions

    • Leverage the His tag for purification using anti-His antibodies or Ni-NTA resin

    • Analyze interacting partners by mass spectrometry

  • Liposome reconstitution assays:

    • Reconstitute purified DDB_G0281339 into liposomes

    • Add potential binding partners and assess interaction through co-flotation or other biophysical techniques

  • Native co-expression systems:

    • Return to the Dictyostelium system with tagged versions of DDB_G0281339

    • Perform immunoprecipitation under native conditions

When designing these experiments, include appropriate controls to distinguish specific from non-specific interactions, particularly important when working with hydrophobic transmembrane proteins that may exhibit sticky properties.

How can bioinformatic approaches help predict potential functions of DDB_G0281339?

Bioinformatic approaches provide powerful prediction tools for uncharacterized proteins like DDB_G0281339:

For DDB_G0281339 specifically:

  • Begin with transmembrane topology prediction to understand membrane orientation

  • Search for conserved motifs within the 224 amino acid sequence

  • Compare with other Dictyostelium transmembrane proteins with known functions

  • Leverage the dictyBase resource for Dictyostelium-specific information

  • Consider creating multiple sequence alignments with related proteins from other species

Remember that bioinformatic predictions should guide experimental design rather than replace experimental validation. The predictions provide hypotheses that must be tested through the functional approaches described in previous sections.

What controls are essential when designing experiments with recombinant DDB_G0281339?

Proper experimental controls are crucial when working with uncharacterized proteins like DDB_G0281339:

  • Expression vector controls:

    • Empty vector control (containing tag but no protein)

    • Irrelevant protein control (unrelated protein with same tag)

    • These controls help distinguish tag-specific from protein-specific effects

  • Protein quality controls:

    • Size exclusion chromatography to verify monodispersity

    • Thermal stability assays to confirm proper folding

    • Western blot analysis to confirm expected molecular weight and absence of degradation

  • Functional assay controls:

    • Negative control: heat-denatured DDB_G0281339

    • Positive control: well-characterized transmembrane protein expressed under identical conditions

    • Concentration gradients to establish dose-dependent effects

  • System-specific controls:

    • For Dictyostelium studies: wild-type, knockout, and rescue experiments

    • For heterologous expression: untransfected cells and cells expressing non-functional mutants

  • Detergent controls (for experiments involving membrane proteins):

    • Detergent-only controls to account for detergent effects on assays

    • Multiple detergent types to ensure results aren't detergent-specific artifacts

By systematically employing these controls, researchers can distinguish true biological activities of DDB_G0281339 from artifacts related to tags, expression systems, or experimental conditions.

How should researchers approach phenotypic analysis of DDB_G0281339 knockout or knockdown in Dictyostelium?

When analyzing phenotypic effects of DDB_G0281339 disruption in Dictyostelium, consider this structured approach:

  • Generation of genetic models:

    • Create complete knockout strains using CRISPR-Cas9 or homologous recombination

    • Develop inducible knockdown systems for temporal control

    • Establish rescue lines expressing wild-type or mutant versions

    • Access the Dicty Stock Center (DSC) which maintains Dictyostelium strains including natural isolates and targeted mutants

  • Growth and development analysis:

    • Measure growth rates in axenic medium and on bacterial lawns

    • Assess timing and morphology of developmental stages

    • Evaluate fruiting body formation and spore viability

    • These analyses leverage Dictyostelium's unique life cycle which includes unicellular and multicellular phases

  • Cell biological analysis:

    • Membrane dynamics (using fluorescent lipid probes)

    • Organelle morphology and distribution

    • Cytokinesis and cell division timing

    • Cell motility and chemotaxis assays

  • Molecular phenotyping:

    • Transcriptomics to identify compensatory or downstream changes

    • Proteomics to assess effects on protein complexes

    • Lipidomics to identify changes in membrane composition

    • Analysis of signaling pathway activation

  • Stress response testing:

    • Challenge cells with osmotic, oxidative, or nutrient stresses

    • Test resistance to various compounds, particularly those affecting membrane integrity

    • Assess response to drugs like cisplatin, where Dictyostelium has proven valuable for understanding mechanisms

Document phenotypes comprehensively using quantitative metrics rather than qualitative descriptions to facilitate reproducibility and statistical analysis.

How can researchers address inconsistent results when working with DDB_G0281339?

Inconsistent results with uncharacterized proteins like DDB_G0281339 are common but can be systematically addressed:

  • Protein stability assessment:

    • Verify protein integrity before each experiment through SDS-PAGE

    • Monitor potential degradation using western blotting

    • Consider time-course stability studies under storage and experimental conditions

    • Follow recommended storage protocols (aliquoting, avoiding freeze-thaw cycles)

  • Expression system variables:

    • Document and control expression conditions (temperature, induction time, media composition)

    • Consider expression batch effects and maintain detailed records

    • Use the same protein preparation for related experiments when possible

  • Experimental condition standardization:

    • Develop detailed standard operating procedures (SOPs)

    • Control buffer composition, pH, and temperature precisely

    • For transmembrane proteins, consistency in membrane/detergent environment is critical

  • Technical replication strategies:

    • Increase technical replication for variable assays

    • Perform experiments on different days with different protein preparations

    • Blind experimenters to sample identity when possible

  • Statistical approaches:

    • Use appropriate statistical tests that account for variability

    • Consider Bayesian approaches for analyzing variable data

    • Implement power analyses to determine adequate sample sizes

When publishing research on uncharacterized proteins, transparently report variability and the steps taken to address it rather than selectively reporting consistent results.

What approaches can differentiate between true findings and artifacts when studying an uncharacterized protein?

Distinguishing true findings from artifacts requires rigorous validation across multiple approaches:

  • Orthogonal method validation:

    • Confirm key findings using fundamentally different methodologies

    • For interaction studies, combine physical (co-IP) and genetic (synthetic lethality) approaches

    • For localization, use both fluorescent tagging and subcellular fractionation

  • Structure-function analyses:

    • Create targeted mutations based on sequence analysis

    • Assess whether mutations affect predicted functions in predictable ways

    • Focus on conserved residues identified through comparative genomics

  • In vivo relevance demonstration:

    • Connect in vitro findings to cellular phenotypes

    • Demonstrate biological significance through rescue experiments

    • Show dose-dependency and specificity of observed effects

  • Cross-species validation:

    • Test whether findings translate to homologous proteins in other organisms

    • Leverage Dictyostelium's evolutionary position between yeast and mammals

    • Express human homologs in Dictyostelium knockout strains to test functional conservation

  • Comprehensive controls:

    • Include all controls described in section 3.3

    • Add system-specific controls based on experimental design

    • Consider "impossible" control experiments that should produce negative results

By implementing these validation approaches, researchers can build a compelling case for the true biological functions of uncharacterized proteins like DDB_G0281339, advancing our understanding of membrane protein biology across evolutionary boundaries.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.