Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0283675 (DDB_G0283675)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0283675; Uncharacterized transmembrane protein DDB_G0283675
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-392
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0283675
Target Protein Sequence
MKLNNSFFFMSVIFVFLIIIQFSTATYSKSEIEYYKRFGYNLETGEYTRSSPHQHQQQYQ QQPQSRQRNRHNSRYGSERRSRQNPYNEDYYSNQNYYQQTSNDLDETAPVYKQGVSIPKN INVGISIDEVTPNVIVETNKPTFSQSLTKPTEKPTLPLKPSIEPTLPTTRKPVEPEPKKT LPPTTQPPETISPKSQTTPAITQHQISTPSPSQQSHHFFYGDGRPAGAGTDDKEEEETKT PTRTHKPINIDDDDDDDETKKPTRLNNNDNNKNNNHRNNNNNKDDDDEDEDEDENKNKNK NKGKPNIDDEDNDEDDDEPEETEEPTITGSIEEAKTPDPNLIEGYSSESDPSGSQSTHED NLIATQSNSSGKISITFFSFIIFSFTIVFFLI
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it a valuable model for transmembrane protein research?

Dictyostelium discoideum is a social amoeba with a unique life cycle comprising a unicellular growth phase and a 24-hour multicellular developmental phase with distinct stages. It serves as an inexpensive and high-throughput model system for studying various fundamental cellular and developmental processes including cell movement, chemotaxis, differentiation, and autophagy . The value of Dictyostelium for transmembrane protein research stems from several key advantages. First, its fully sequenced, low redundancy genome provides a less complex system to work with while maintaining many genes and related signaling pathways found in more complex eukaryotes . Second, its haploid genome allows researchers to introduce one or multiple gene disruptions with relative ease, enabling straightforward functional studies of transmembrane proteins . Third, the availability of various expression constructs facilitates studies on protein localization and function, which is particularly valuable for membrane proteins . Additionally, Dictyostelium's resistance to DNA damaging agents and conservation of DNA repair factors make it useful for studying protein function under various cellular stress conditions .

What genetic tools are available for studying DDB_G0283675 and other uncharacterized transmembrane proteins?

Researchers have access to several sophisticated genetic tools for studying uncharacterized transmembrane proteins in Dictyostelium:

  • CRISPR-based gene disruption: As described by Yamashita et al., CRISPR technology has been successfully applied in Dictyostelium, allowing precise genetic manipulation of transmembrane protein genes .

  • Insertional mutagenesis: Insertional mutant libraries facilitate pharmacogenetic screens that enhance our understanding of protein function at a cellular level .

  • Expression constructs: A variety of expression vectors are available that enable studies on protein localization and function in Dictyostelium, which is critical for transmembrane protein characterization .

  • Gene knockout techniques: The haploid nature of the Dictyostelium genome allows straightforward generation of knockout strains to study transmembrane protein function .

  • Positive selection high-throughput genetic screens: Williams et al. reported the development of new positive selection high-throughput genetic screening methods that can accelerate the characterization of proteins like DDB_G0283675 .

How does Dictyostelium's life cycle impact experimental design for transmembrane protein studies?

Dictyostelium's unique life cycle significantly influences experimental design for transmembrane protein research. During the unicellular growth phase, researchers can study the role of transmembrane proteins in single-cell processes like phagocytosis, chemotaxis, and cell division . When transitioning to the multicellular developmental phase, investigations can focus on the protein's role in cell-cell communication, differentiation, and morphogenesis . This developmental transition offers a valuable opportunity to study the same transmembrane protein under different cellular contexts within a 24-hour period.

For transmembrane proteins like DDB_G0283675, experimental designs must account for potential stage-specific expression and function. Research should incorporate both growth phase and developmental time points for comprehensive characterization. For example, McLaren et al. demonstrated how knockout of a specific gene affected both growth and multicellular development by impacting autophagy . Similarly, when studying DDB_G0283675, phenotypic analyses should span both unicellular and multicellular stages to fully capture the protein's functional spectrum.

What methodological approaches are most effective for initial characterization of an uncharacterized transmembrane protein like DDB_G0283675?

For initial characterization of uncharacterized transmembrane proteins, a multi-faceted approach is recommended:

Sequence Analysis and Structural Prediction:

  • Conduct bioinformatic analysis to identify conserved domains, transmembrane regions, and potential functional motifs

  • Perform phylogenetic analysis to identify potential orthologs in other species

  • Use structural prediction tools to generate hypotheses about protein topology

Localization Studies:

  • Create fluorescent protein fusions to determine subcellular localization

  • Utilize available expression constructs optimized for Dictyostelium to visualize protein distribution

  • Employ co-localization experiments with known organelle markers to refine localization data

Expression Analysis:

  • Quantify expression levels across different developmental stages

  • Analyze expression under various stress conditions to identify regulatory patterns

  • Compare expression in different genetic backgrounds

Functional Disruption:

  • Generate knockout strains using CRISPR-based methods as described by Yamashita et al.

  • Create knockdown strains if complete knockout is lethal

  • Develop inducible expression systems for temporal control of protein function

This integrated approach provides a comprehensive initial characterization framework that generates testable hypotheses about protein function while leveraging the genetic tractability of Dictyostelium.

How can I design experiments to resolve contradictory data when studying transmembrane protein function?

When faced with contradictory data in transmembrane protein research, a systematic experimental design approach is essential:

  • Cross-validation with independent methods:

    • If localization data is contradictory, employ both N- and C-terminal tags

    • Confirm protein expression using both Western blotting and immunofluorescence

    • Validate knockout phenotypes with complementation experiments

  • Genetic background considerations:

    • Generate mutations in multiple Dictyostelium strains to rule out strain-specific effects

    • Create double knockouts with interacting partners to uncover compensatory mechanisms

    • Use the genetic tractability of Dictyostelium to introduce point mutations rather than complete gene disruption

  • Temporal and developmental considerations:

    • Analyze protein function at multiple developmental time points

    • Use inducible systems to distinguish between acute and chronic loss of function

    • Consider the delayed kinetics of DSB repair observed in Dictyostelium when studying proteins involved in DNA damage responses

  • Environmental variables:

    • Test protein function under various stress conditions

    • Consider the impact of pH on protein function, as demonstrated by Ishikawa-Ankerhold et al. for cytoplasmic rod formation

    • Evaluate function under different nutrient conditions

This structured approach leverages the experimental advantages of Dictyostelium to systematically address contradictory data and develop a more coherent understanding of transmembrane protein function.

What quantitative and qualitative methods should be combined for comprehensive transmembrane protein characterization?

A comprehensive characterization of transmembrane proteins requires integration of both quantitative and qualitative methodologies:

Quantitative Methods:

  • Precise measurements of protein expression levels using qPCR and Western blotting

  • Specific data variables including membrane localization percentages and transport kinetics

  • Large sample sizes to ensure statistical robustness

  • Randomly selected cells for unbiased analysis

  • Generation of results generalizable to larger populations

  • Objective measurement criteria

Implementation approaches: Surveys, questionnaires, experiments, analyzing existing genomic and proteomic data

Qualitative Methods:

  • Open-ended investigations of protein function in different cellular contexts

  • Non-specific data collection to identify unexpected functions

  • Focused studies on small sample sizes for detailed mechanistic insights

  • Investigation of situational or highly specific protein interactions

  • Subjective assessment of phenotypic outcomes

Implementation approaches: Case studies, action research, participant observation, phenomenological approaches

Mixed Method Integration:
For transmembrane proteins like DDB_G0283675, mixed methods are particularly valuable. For example, combining quantitative measurements of membrane trafficking rates with qualitative assessment of protein-protein interactions provides a more complete functional picture than either approach alone. This integration allows researchers to connect measurable protein characteristics with their biological significance in complex cellular processes.

How should I approach membrane protein extraction and purification for biochemical studies of DDB_G0283675?

Membrane protein extraction and purification from Dictyostelium requires specialized protocols to maintain protein integrity:

Extraction Protocol Optimization:

Extraction MethodAdvantagesLimitationsBest For
Detergent-based extractionEfficient solubilizationMay disrupt protein-protein interactionsStructural studies
Native membrane isolationPreserves protein complexesLower yieldFunctional studies
Gradient fractionationSeparates different membrane compartmentsTime-consumingLocalization studies
Affinity purificationHigh specificityRequires taggingInteraction studies

Critical Parameters for DDB_G0283675 Purification:

  • Buffer composition: pH optimization is crucial as demonstrated by Ishikawa-Ankerhold et al. for protein behavior in Dictyostelium

  • Detergent selection: Start with mild detergents (DDM, CHAPS) to maintain protein folding

  • Salt concentration: Titrate to balance extraction efficiency with protein stability

  • Temperature control: Perform all steps at 4°C to minimize proteolysis

  • Protease inhibitors: Include complete inhibitor cocktail to prevent degradation

Verification Methods:

  • Western blotting with specific antibodies or tag detection

  • Mass spectrometry for protein identification and post-translational modification analysis

  • Functional assays to confirm that purified protein retains activity

This systematic approach maximizes the likelihood of obtaining functional transmembrane protein for downstream biochemical and structural characterization.

What are the most effective strategies for studying protein-protein interactions involving transmembrane proteins in Dictyostelium?

For studying protein-protein interactions involving transmembrane proteins like DDB_G0283675 in Dictyostelium, several complementary approaches should be employed:

In vivo approaches:

  • Proximity labeling: BioID or APEX2 tags can identify neighboring proteins in the membrane environment

  • FRET/BRET analysis: For detecting direct interactions between fluorescently tagged proteins

  • Co-immunoprecipitation: Optimized for membrane proteins using appropriate detergents

  • Genetic interaction screens: Synthetic lethality or suppressor screens to identify functional interactions

Visualization approaches:

  • Co-localization studies: Using the variety of expression constructs available for Dictyostelium

  • Live-cell imaging: To track dynamic interactions during different life cycle stages

  • Split-fluorescent protein complementation: For verification of direct interactions

Biochemical validation:

  • Pull-down assays: Using recombinant protein domains

  • Crosslinking mass spectrometry: To capture transient interactions

  • Surface plasmon resonance: For quantitative interaction measurements

Technical considerations specific to Dictyostelium:

  • Leverage the haploid genome to introduce tagged versions of interaction partners without competition from untagged versions

  • Consider developmental timing, as protein interactions may change during the transition from unicellular to multicellular stages

  • Account for the impact of pH on protein interactions as demonstrated in Dictyostelium research

This multi-faceted approach provides complementary lines of evidence for protein interactions, essential for building confidence in interaction networks involving uncharacterized transmembrane proteins.

How can advanced imaging techniques be applied to study the dynamics of transmembrane proteins in Dictyostelium?

Advanced imaging techniques offer powerful tools for studying transmembrane protein dynamics in Dictyostelium:

Super-resolution microscopy applications:

  • PALM/STORM: Achieve 20-30nm resolution to visualize nanoscale distribution of transmembrane proteins

  • STED microscopy: Particularly useful for studying protein clusters in membrane microdomains

  • SIM: Provides improved resolution while maintaining live-cell compatibility

Live-cell imaging approaches:

  • Single-particle tracking: Monitor individual protein movement in the membrane

  • FRAP analysis: Measure diffusion rates and immobile fractions of membrane proteins

  • Optogenetics: Control protein activity with light to study dynamic responses

Implementation considerations for Dictyostelium:

  • Cell immobilization: Develop protocols compatible with amoeboid movement

  • Developmental stage selection: Image both unicellular and multicellular stages as protein dynamics may differ

  • Fluorophore selection: Choose tags that maintain protein function and localization

Case study application:
Hörning et al. demonstrated the dynamics of PIP3 activity in amoeboid cells using advanced imaging techniques . Similar approaches can be applied to study DDB_G0283675 dynamics, particularly in response to environmental stimuli or during developmental transitions. For transmembrane proteins involved in signaling, these techniques can reveal activation kinetics and spatial regulation.

By combining these advanced imaging approaches, researchers can obtain detailed insights into the dynamic behavior of transmembrane proteins that would be impossible with static or bulk biochemical methods.

What bioinformatic approaches are most useful for predicting functions of uncharacterized transmembrane proteins?

Predicting functions of uncharacterized transmembrane proteins like DDB_G0283675 requires specialized bioinformatic approaches:

Sequence-based prediction tools:

  • Transmembrane topology prediction: TMHMM, Phobius, and TOPCONS to identify membrane-spanning regions

  • Domain identification: InterPro, Pfam, and SMART to recognize functional domains

  • Motif analysis: ELM and ScanProsite to identify short functional motifs

  • Post-translational modification sites: NetPhos and NetOGlyc for potential regulatory sites

Structural prediction approaches:

  • Ab initio modeling: Using programs optimized for membrane proteins (ROSETTA-MP)

  • Template-based modeling: Leveraging structural homology to characterized proteins

  • Molecular dynamics simulations: To predict dynamic behavior in membrane environments

Comparative genomics:

  • Ortholog identification: Leverage the presence of Dictyostelium orthologs of several DNA repair pathway components otherwise limited to vertebrates

  • Synteny analysis: Examine conservation of genomic context across species

  • Phylogenetic profiling: Identify co-evolving proteins that may function together

Integrative prediction:

  • Network-based inference: Predict function based on interaction partners

  • Co-expression analysis: Identify genes with similar expression patterns

  • Phenotype-based prediction: Compare to phenotypes of characterized genes

This multi-layered bioinformatic approach provides a foundation for generating testable hypotheses about the function of uncharacterized transmembrane proteins, which can then be validated experimentally using Dictyostelium's genetic tractability.

How should I interpret phenotypic data from DDB_G0283675 knockout studies in relation to potential human disease connections?

Interpreting phenotypic data from transmembrane protein knockout studies in Dictyostelium requires careful consideration, especially when making connections to human disease:

Systematic phenotypic analysis framework:

  • Developmental phenotyping:

    • Document all stages of the 24-hour developmental cycle

    • Quantify timing and morphology at each stage

    • Compare to wild-type development under identical conditions

    • Consider parallels to human developmental processes

  • Cellular process assessment:

    • Analyze fundamental processes (phagocytosis, macropinocytosis, chemotaxis)

    • Quantify growth rates in different media conditions

    • Assess resistance to various stressors, particularly DNA damaging agents

    • Examine autophagy efficiency, a process relevant to many human diseases

  • Molecular function evaluation:

    • Investigate potential involvement in DNA repair pathways conserved between Dictyostelium and humans

    • Examine effects on signaling pathways similar to those in mammalian cells

    • Consider impacts on mitochondrial function, relevant to Parkinson's disease mechanisms

  • Translational interpretation:

    • Look for conservation of the phenotype in orthologous human gene mutations

    • Consider how Dictyostelium's resistance to DNA damaging agents may provide insights into tumor resistance to chemotherapy

    • Recognize that phenotypes may manifest differently in single-celled versus tissue contexts

  • Validation approaches:

    • Perform genetic rescue experiments with both Dictyostelium and human orthologs

    • Create equivalent mutations in human cell lines to confirm conservation of function

    • Develop appropriate disease models based on initial phenotypic observations

This structured approach to phenotypic analysis maximizes the translational value of Dictyostelium studies, as demonstrated by successful applications in Parkinson's disease and Batten disease research .

What statistical methods are appropriate for analyzing complex datasets from transmembrane protein studies?

Analyzing complex datasets from transmembrane protein studies requires appropriate statistical approaches:

Experimental Design Considerations:

  • Ensure sufficient biological replicates (minimum n=3, preferably n≥5)

  • Include appropriate controls (wild-type, empty vector, unrelated protein knockout)

  • Account for batch effects and experimental variability

  • Design factorial experiments to detect interaction effects between variables

Statistical Analysis Framework:

Data TypeRecommended TestsVisualizationNotes
Gene expressionANOVA, t-test, limmaHeatmaps, volcano plotsAccount for multiple testing with FDR correction
Protein localizationChi-square, Fisher's exact testStacked bar chartsCategorize localization patterns
Growth/developmental ratesRepeated measures ANOVALine graphs with error barsConsider non-linear growth models
Phenotypic categorizationChi-square, Fisher's exact testMosaic plotsDefine categories before analysis
Protein-protein interactionsPermutation tests, bootstrappingInteraction networksControl for false positives
Multi-omics integrationPCA, clustering, WGCNADimension reduction plotsConsider data normalization strategies

Advanced Analysis Approaches:

  • Machine learning classification: For complex phenotypic analysis

  • Bayesian networks: To infer causal relationships in signaling pathways

  • Time-series analysis: For developmental and dynamic process data

  • Multivariate analysis: To identify patterns across multiple parameters

Implementation guidance:

  • Use R or Python for reproducible statistical analysis

  • Document all analysis steps in detail

  • Make raw data and analysis code available to the research community

  • Consider consulting with a biostatistician for complex experimental designs

How can findings from Dictyostelium transmembrane protein studies be translated to human disease research?

Translating findings from Dictyostelium transmembrane protein studies to human disease research requires strategic approaches:

Translation strategies:

  • Ortholog validation: Confirm functional conservation by expressing human orthologs in Dictyostelium knockout strains

  • Pathway conservation analysis: Focus on signaling pathways that regulate cell behavior similarly in Dictyostelium and mammalian cells

  • Disease-relevant phenotype screening: Look for phenotypes that parallel human disease manifestations, as demonstrated in Parkinson's and Batten disease studies

  • Drug response profiling: Use insertional mutant libraries for pharmacogenetic screens to understand compound mechanisms at a cellular level

Case studies of successful translation:

  • McLaren et al. demonstrated that knockout of the Dictyostelium ortholog of human CLN5 impacts growth and development by affecting autophagy, providing insights into Batten disease mechanisms

  • Rosenbusch et al. linked mutations in Parkinson's disease-associated genes to aberrant mitochondrial activity using Dictyostelium

  • DNA repair pathway studies in Dictyostelium have provided insights into mechanisms of tumor resistance to chemotherapy

Implementation framework:

  • Identify conserved functional domains in the transmembrane protein of interest

  • Determine if human orthologs can complement Dictyostelium knockout phenotypes

  • Test disease-associated mutations in the Dictyostelium system

  • Validate key findings in mammalian cell culture models

  • Develop collaborations with clinical researchers to access patient samples

This structured approach leverages the experimental advantages of Dictyostelium while ensuring relevant translation to human disease contexts.

What emerging technologies will advance the study of uncharacterized transmembrane proteins in Dictyostelium?

Several emerging technologies promise to revolutionize the study of uncharacterized transmembrane proteins in Dictyostelium:

Genome engineering advances:

  • Next-generation CRISPR tools: Base editors and prime editors for precise genetic modifications

  • CRISPR interference/activation: For tunable gene expression without permanent modification

  • Large-scale genetic screens: Combining CRISPR with next-generation sequencing for functional genomics

  • Synthetic genetic circuits: For controlled expression and pathway reconstitution

Structural biology breakthroughs:

  • Cryo-EM for membrane proteins: Allowing structural determination without crystallization

  • Integrative structural biology: Combining multiple data types for complete structural models

  • In-cell structural studies: NMR and EPR approaches to study proteins in native environments

Advanced imaging innovations:

  • Correlative light and electron microscopy: To connect protein function to ultrastructural context

  • 4D live cell imaging: For tracking protein dynamics across space and time

  • Expansion microscopy: To visualize nanoscale organization of membrane proteins

  • Label-free imaging: For studying proteins in their native state without tags

Multi-omics integration:

  • Spatial transcriptomics: To connect gene expression with subcellular localization

  • Proteomics advances: Improved techniques for membrane proteome analysis

  • Metabolomics integration: To connect transmembrane protein function with metabolic outcomes

  • Single-cell multi-omics: For understanding cellular heterogeneity in protein function

These emerging technologies will enable researchers to address currently intractable questions about transmembrane protein structure, function, and dynamics in Dictyostelium, accelerating the characterization of proteins like DDB_G0283675.

How can computational modeling enhance our understanding of transmembrane protein function in Dictyostelium?

Computational modeling offers powerful approaches to enhance our understanding of transmembrane protein function:

Molecular dynamics simulations:

  • Membrane embedding simulations: Predict stable protein conformations in lipid bilayers

  • Ligand binding studies: Identify potential binding sites and interaction partners

  • Conformational change modeling: Understand the structural basis of protein function

  • Molecular docking: Predict interactions with other proteins or small molecules

Systems biology modeling:

  • Pathway reconstruction: Build mechanistic models of signaling pathways involving transmembrane proteins

  • Flux balance analysis: Understand the impact of transmembrane transporters on cellular metabolism

  • Agent-based modeling: Simulate emergent behaviors in multicellular development

  • Network analysis: Identify the position of transmembrane proteins in cellular interaction networks

Integration with experimental data:

  • Parameter estimation from experimental measurements: Refine models with quantitative data

  • Hypothesis generation and testing cycles: Use models to predict outcomes of new experiments

  • Sensitivity analysis: Identify key parameters controlling system behavior

  • Multi-scale modeling: Connect molecular mechanisms to cellular and multicellular phenotypes

Implementation in Dictyostelium research:
Computational models could help understand the different kinetics of DNA repair pathways observed in Dictyostelium or the mechanisms regulating chemotaxis as studied by Kamimura and Ueda . For transmembrane proteins like DDB_G0283675, modeling can predict functional roles based on structural features and potential interaction partners.

This computational approach complements experimental studies by providing mechanistic insights, generating testable hypotheses, and helping to interpret complex experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.