Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0283731 (DDB_G0283731)

Shipped with Ice Packs
In Stock

Description

General Information

  • Nomenclature: DDB_G0283731 is a protein identified in the cellular slime mold Dictyostelium discoideum . The "DDB" prefix refers to Dictyostelium discoideum . "G0283731" is a unique identifier for this particular gene or protein within the Dictyostelium discoideum genome databases.

  • Nature: DDB_G0283731 is a transmembrane protein, meaning it is located within and spans biological membranes . Transmembrane proteins often play roles in cell signaling, transport, and maintaining cell structure.

  • Recombinant Production: Recombinant DDB_G0283731 implies that the protein has been produced using recombinant DNA technology, typically in a host organism like E. coli . This involves introducing the gene encoding DDB_G0283731 into the host, which then produces the protein.

Dictyostelium discoideum as a Model Organism

Dictyostelium discoideum is a valuable model organism for studying various aspects of cell and developmental biology . It is used in research areas such as:

  • Cell motility.

  • Cell adhesion.

  • Macropinocytosis and phagocytosis.

  • Host-pathogen interactions.

  • Multicellular development .
    *Recent studies suggest that Dictyostelium and other genera of cellular slime molds could be sources for novel lead compounds applicable in pharmacological and medical research .

Protein Structure

Proteins are composed of amino acids linked by peptide bonds, forming a polypeptide chain . The sequence of amino acids determines the protein's primary structure, which dictates its shape and function2. Protein structure is organized into four levels2:

Recombinant Protein Production in Dictyostelium

Dictyostelium discoideum can efficiently secrete recombinant proteins . This capability has been utilized to produce useful amounts of recombinant proteins using Dictyostelium as a host/vector system . Examples of recombinant proteins produced in Dictyostelium include:

  • A soluble form of the D. discoideum glycoprotein PsA.

  • Glutathione-S-transferase (GST) from Schistosoma japonicum .

Potential Functions of DDB_G0283731

  • Cell Signaling: Transmembrane proteins often act as receptors or参与 in signal transduction pathways, relaying information from the cell's exterior to its interior.

  • Transport: It could be involved in transporting molecules across the cell membrane.

  • Structural Role: It may play a role in maintaining cell structure or участвовать in cell-cell interactions.
    *Further research, such as identifying interacting partners and studying its expression patterns, would be needed to elucidate its specific function.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
DDB_G0283731; Uncharacterized transmembrane protein DDB_G0283731
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0283731
Target Protein Sequence
MLSRATRLLSTKNVVVNSIVKHTTIRSFASHGGGEAGGAYPTEPEAGTQMITRRVEFGDA VYSYKHGNFIVDPIQIRELAEEQQQQQHHVHGPGCSHGHHHDSHANDGHHDEHHDEHHDH VNPDDVEDEFPRGYFLNTPPSVPYPMNPYYLTALCLLPIIGSLFSIRYFDNKSENDYELF RSEYLEANPALKQKYYDITHKYPLSH
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable for studying transmembrane proteins?

D. discoideum is a social amoeba that serves as an important model organism for biomedical research. It offers several advantages for studying transmembrane proteins:

  • Its genome is fully sequenced and contains approximately 12,500 genes

  • It is highly amenable to genetic manipulation

  • It expresses numerous membrane proteins involved in environmental sensing

  • It possesses 61 putative G-protein-coupled receptors (GPCRs), including 17 glutamate receptor-like proteins (Grls)

  • It serves as a well-established host model for studying interactions with bacteria and, to a lesser extent, fungi

The professional phagocytic nature of D. discoideum makes it particularly suitable for studying transmembrane proteins involved in pathogen recognition and response pathways.

What bioinformatic approaches should be used for initial characterization of DDB_G0283731?

Initial bioinformatic characterization of DDB_G0283731 should include:

Analysis TypeMethodologyExpected Outcome
Sequence analysisTMHMM, Phobius, TOPCONSPrediction of transmembrane domains
Homology searchesBLAST, HHpred, AlphaFoldIdentification of potential orthologs
Domain predictionInterPro, SMART, PfamDetection of functional motifs
Phylogenetic analysisMEGA, PhyML, MrBayesEvolutionary context placement
Structural predictionAlphaFold, RoseTTAFold3D structural model
Post-translational modificationNetNGlyc, NetPhosIdentification of potential modification sites

This comprehensive bioinformatic approach provides the foundation for experimental characterization by generating testable hypotheses about protein function and guiding the design of molecular experiments.

How can transcriptomic data help understand the potential function of DDB_G0283731?

Transcriptomic analysis can provide valuable insights into when and under what conditions DDB_G0283731 is expressed, helping to infer its potential function:

  • RNA-seq analysis under different conditions (bacterial exposure, development, stress)

  • Comparison with expression patterns of genes with known functions

  • Identification of co-regulated genes through cluster analysis

From existing research, we know that D. discoideum responds very differently at the transcriptional level when exposed to different bacteria . For example:

Bacterial SpeciesTranscriptional ResponseNumber of Differentially Expressed Genes
B. subtilisStrong787
K. pneumoniae (Kp21)Moderate245
K. pneumoniae (KpGe)Moderate116
M. marinumModerate162
M. luteusNone0
Folate (1 mM)Limited27

If DDB_G0283731 shows specific expression patterns in response to particular bacteria, this would suggest potential involvement in pathogen recognition or response pathways.

What expression systems are recommended for recombinant production of DDB_G0283731?

For recombinant expression of a transmembrane protein like DDB_G0283731, several expression systems can be considered:

Expression SystemAdvantagesDisadvantagesRecommended Tags
D. discoideumNative post-translational modifications, proper foldingLower yieldsGFP, FLAG, His6
Mammalian cells (HEK293)Similar membrane composition to DictyosteliumCost, time-consumingHis6, FLAG, EGFP
Insect cellsHigh expression of eukaryotic membrane proteinsComplex culture conditionsHis6, Twin-Strep
Cell-free systemsRapid, direct incorporation into nanodiscsLimited post-translational modificationsHis6, Strep II
E. coliHigh yield, simple cultureImproper folding of eukaryotic proteinsMBP, SUMO, His6

For transmembrane proteins, solubilization conditions are critical. A detergent screening approach is typically necessary to identify optimal conditions:

Detergent ClassExamplesBest for
Mild non-ionicDDM, LMNGInitial extraction
Facial amphiphilesCHAPS, Fos-cholineDifficult-to-solubilize proteins
Polymer-basedSMA, DIBMANative lipid environment retention
Lipid-likeGDN, MNG-3Enhanced stability

What phenotypic assays can determine the function of DDB_G0283731 in D. discoideum?

Several phenotypic assays can help identify the function of transmembrane proteins in D. discoideum:

Assay TypeMethodologyPotential Findings
Growth assaysPlaque formation on bacterial lawnsPhagocytosis defects
Phagocytosis assaysUptake of fluorescent bacteria/beadsBacterial recognition defects
Bacterial resistanceCo-culture with pathogensAltered susceptibility to infection
Chemotaxis assaysUnder-agarose folate chemotaxisDefects in bacterial sensing
Development assaysMulticellular development timingCell-cell communication defects
Endocytosis trackingFluorescent markers of endocytic pathwayVesicle trafficking abnormalities

The search results show that D. discoideum mutants in genes like atg1, kil1, and kil2 display altered ability to predate yeast cells , demonstrating how phenotypic assays can reveal gene function.

How can CRISPR-based approaches be optimized for studying DDB_G0283731 function?

CRISPR-Cas9 technology offers powerful tools for genetic manipulation of D. discoideum:

CRISPR StrategyMethodologyApplication for DDB_G0283731
Complete knockoutHDR-mediated gene deletionDetermine essential nature of the protein
Domain-specific editingPrecise mutations of key domainsIdentify functional domains
Knock-in taggingC/N-terminal fluorescent protein fusionVisualize subcellular localization
CRISPRidCas9-mediated transcriptional repressionTemporal control of expression
Base editingTargeted nucleotide substitutionsStructure-function studies
Prime editingPrecise edits without DSBsMinimal disruption of genomic context

When designing CRISPR strategies for transmembrane proteins, special consideration should be given to:

  • Targeting extracellular versus intracellular domains

  • Preserving membrane topology

  • Maintaining protein stability after editing

  • Considering the impact on protein-protein interactions

How might DDB_G0283731 function in bacterial recognition pathways?

To investigate the potential role of DDB_G0283731 in bacterial recognition:

Experimental ApproachMethodologyExpected Outcome if Involved
Bacterial challengeExposure to diverse bacterial species Differential phagocytosis/killing efficiency
Localization studiesLive imaging during bacterial uptakeRecruitment to phagocytic cup/phagosome
Transcriptional analysisRNA-seq of wild-type vs. knockoutAltered transcriptional response to bacteria
Proteomic analysisPhagosome proteomicsAbsence from phagosomes in knockout cells

D. discoideum lacks traditional Toll-like receptors but possesses cytosolic proteins with TIR domains and approximately 100 proteins containing leucine-rich repeats (LRRs) that could function as pattern recognition receptors . If DDB_G0283731 is involved in bacterial recognition, it might interact with these pathways.

What approaches can determine if DDB_G0283731 functions in signal transduction pathways?

To investigate DDB_G0283731's role in signal transduction:

ApproachMethodologyData Analysis
PhosphoproteomicsMS/MS analysis after stimulationIdentification of phosphorylation changes
Interactome analysisBioID, APEX proximity labelingConstruction of protein interaction networks
Calcium signalingFura-2 or GCaMP calcium imagingMeasurement of calcium fluxes after stimulation
Second messenger assaysFRET-based biosensorsReal-time visualization of signaling events
Transcriptional reportersLuciferase/GFP under responsive promotersQuantification of downstream activation

The search results show that certain Grl proteins (grlG/far2 and grlL/far1) are proposed to function as receptors for folate and bacterial LPS . Similar approaches could be used to determine if DDB_G0283731 functions in comparable signaling pathways.

How can mutant complementation strategies validate DDB_G0283731 function?

Complementation strategies are essential for confirming the specificity of phenotypes observed in DDB_G0283731 knockout strains:

Complementation StrategyMethodologyValidation Criteria
Wild-type expressionReintroduction of native geneComplete phenotype rescue
Domain mutantsExpression of proteins with specific mutationsDomain-specific function identification
Chimeric proteinsFusion with domains from related proteinsDetermination of functional domains
Heterologous expressionIntroduction of orthologs from other speciesConservation of function
Inducible expressionTetracycline-controlled promotersTemporal control of complementation

For transmembrane proteins like DDB_G0283731, special considerations include:

  • Ensuring proper membrane targeting

  • Verifying correct topology

  • Maintaining appropriate expression levels

  • Confirming restoration of protein-protein interactions

What advanced imaging techniques can reveal DDB_G0283731 dynamics during phagocytosis?

Advanced imaging approaches provide powerful tools for studying transmembrane protein dynamics during phagocytosis:

Imaging TechniqueApplicationExpected Data
Total Internal Reflection Fluorescence (TIRF)Visualization at cell-substrate interfaceRecruitment dynamics during early phagocytosis
Lattice Light-Sheet Microscopy3D imaging with reduced phototoxicityVolumetric dynamics during cup formation
Single-Molecule Localization MicroscopyNanoscale organizationClustering patterns during signaling
Fluorescence Correlation SpectroscopyDiffusion dynamicsMobility changes during activation
Förster Resonance Energy Transfer (FRET)Protein-protein interactionsReal-time interaction with signaling partners

Such techniques could reveal whether DDB_G0283731 is recruited to phagocytic cups during bacterial engulfment, similar to patterns observed for other membrane proteins involved in phagocytosis in D. discoideum .

How should experiments be designed to study DDB_G0283731 in bacterial response pathways?

Based on research showing that D. discoideum responds differently to various bacterial species , a comprehensive experimental design should include:

Experimental FactorVariables to TestControls
Bacterial speciesGram-positive (B. subtilis, M. luteus), Gram-negative (K. pneumoniae), Mycobacteria (M. marinum) Heat-killed bacteria
Time courseEarly (0-30 min), intermediate (1-4 h), late (>4 h) responses Matched time points without bacteria
Gene expressionRNA-seq, qRT-PCR, reporter constructs Housekeeping genes
Protein localizationLive imaging of tagged DDB_G0283731Non-relevant membrane protein controls
Mutant phenotypesGrowth, phagocytosis, killing efficiency Wild-type and complemented strains

The search results indicate that experiments should be conducted in rich medium (like HL5c) to minimize metabolic adaptation effects, with appropriate antibiotics to prevent bacterial overgrowth .

What controls are essential when analyzing potential interacting partners of DDB_G0283731?

When performing protein-protein interaction studies:

Control TypePurposeImplementation
Bait controlsAccount for non-specific bindingGFP-only, irrelevant transmembrane protein
Stringency controlsOptimize wash conditionsVarying detergent concentrations
Negative controlsIdentify background proteinsParental cell line without tagged protein
Reciprocal taggingValidate interactionsN and C-terminal tags, tag swapping
Competitive bindingConfirm specificityExcess untagged protein
In silico filteringRemove common contaminantsComparison with CRAPome database

For transmembrane proteins like DDB_G0283731, additional considerations include:

  • Using appropriate membrane-compatible crosslinking reagents

  • Employing proximity-based labeling approaches (BioID, APEX)

  • Considering native membrane environments for interaction studies

How can transcriptional regulators of DDB_G0283731 be identified?

To identify factors regulating DDB_G0283731 expression:

ApproachMethodologyExpected Outcome
Promoter analysisBioinformatic prediction of binding sitesCandidate transcription factors
Reporter assaysPromoter-luciferase/GFP constructsQuantitative expression data
Promoter truncationSequential deletions of promoter regionsMinimal regulatory elements
ChIP-seqImmunoprecipitation of chromatinDirect binding evidence
CRISPR interferenceTargeted repression of candidate regulatorsValidation of regulatory relationships

From the search results, we know that different bacteria induce highly specific transcriptional responses in D. discoideum . Identifying the transcriptional regulators of DDB_G0283731 could place it within specific response pathways.

What are the key considerations for structural studies of DDB_G0283731?

Structural characterization of transmembrane proteins requires specialized approaches:

Structural MethodSample RequirementsExpected Resolution
Cryo-electron microscopy~0.1-1 mg purified protein2-4 Å resolution
X-ray crystallographyWell-diffracting crystals1.5-3 Å resolution
Nuclear Magnetic Resonance15N/13C-labeled proteinAtomic resolution of domains
AlphaFold2 predictionSequence information onlyVariable accuracy for transmembrane regions
Cross-linking Mass SpectrometryPartially purified complexesDistance constraints between residues

Critical factors for successful structural studies include:

  • Optimization of expression and purification conditions

  • Selection of appropriate detergents or membrane mimetics

  • Removal of flexible regions that may impede crystallization

  • Consideration of lipid composition effects on protein stability

  • Use of antibodies or nanobodies to stabilize specific conformations

How can post-translational modifications of DDB_G0283731 be characterized?

Post-translational modifications can significantly impact transmembrane protein function:

Modification TypeDetection MethodFunctional Assessment
PhosphorylationPhospho-specific antibodies, MS/MSPhosphomimetic mutations (S/T→D/E)
GlycosylationGlycosidase treatment, lectin blottingN-glycosylation site mutations (N→Q)
UbiquitinationUbiquitin pulldown, MS/MSLysine-to-arginine mutations
PalmitoylationClick chemistry, metabolic labelingCysteine-to-serine mutations
Disulfide bondsNon-reducing SDS-PAGECysteine-to-alanine mutations

For DDB_G0283731, characterizing post-translational modifications could provide insights into:

  • Regulation of protein activity

  • Subcellular trafficking mechanisms

  • Protein stability and turnover

  • Signal transduction mechanisms

  • Interactions with other proteins

How should RNA-seq data be analyzed to understand DDB_G0283731 regulation?

Based on the methodology described in the search results , RNA-seq data analysis for understanding DDB_G0283731 regulation should follow these steps:

Analysis StepMethodologyInterpretation for DDB_G0283731
Quality controlFastQC, trimming of low-quality readsEnsure reliable sequence data
AlignmentMapping to D. discoideum reference genomeQuantify DDB_G0283731 expression
Differential expressionDESeq2 or edgeR analysisIdentify conditions affecting expression
Significance thresholds≥4-fold change, p-value ≤0.01 Determine significant regulation events
VisualizationVolcano plots, heatmaps Contextualize expression changes
Co-expression analysisPearson correlation, WGCNAIdentify genes with similar regulation

The search results describe how different bacteria induce specific transcriptional responses in D. discoideum . Similar analysis of DDB_G0283731 expression patterns could reveal its involvement in specific bacterial response pathways.

What statistical approaches are appropriate for phenotypic analysis of DDB_G0283731 mutants?

When analyzing phenotypic data from DDB_G0283731 mutants:

Phenotypic MeasurementStatistical ApproachVisualization
Growth ratesLinear mixed-effects modelsGrowth curves with confidence intervals
Phagocytosis efficiencyANOVA with post-hoc testsBox plots with individual data points
Bacterial killingSurvival analysisKaplan-Meier curves
Morphological changesPrincipal component analysisScatter plots of PC dimensions
Development timingNon-parametric comparisonsTimeline plots with significance markers

Important considerations include:

  • Using appropriate replicates (biological and technical)

  • Controlling for experimental batch effects

  • Implementing blinded analysis when possible

  • Determining appropriate sample sizes through power analysis

  • Correcting for multiple hypothesis testing

How can evolutionary analysis provide insights into DDB_G0283731 function?

Evolutionary analysis can provide valuable functional insights:

Evolutionary AnalysisMethodologyFunctional Implications
Ortholog identificationReciprocal BLAST, OrthoFinderConservation across species
Sequence conservationMultiple sequence alignmentIdentification of critical residues
Selection pressuredN/dS ratio calculationSites under functional constraint
Domain architectureHMMER, InterProScanFunctional module organization
Phylogenetic profilingCo-occurrence with known pathwaysFunctional association prediction

For transmembrane proteins involved in bacterial interactions, evolutionary analysis can reveal:

  • Host-pathogen co-evolutionary dynamics

  • Regions under positive selection (potentially involved in pathogen recognition)

  • Conservation patterns consistent with structural constraints

  • Lineage-specific adaptations

What approaches can resolve contradictory data about DDB_G0283731 function?

When faced with contradictory experimental results:

Contradiction TypeResolution ApproachImplementation
Expression discrepanciesMulti-method validationqRT-PCR, Western blot, reporter constructs
Phenotypic variationsStandardized conditionsIdentical media, growth phase, bacterial strains
Localization differencesTagged protein validationMultiple tag positions, native antibodies
Interaction inconsistenciesStringency optimizationVarying crosslinking and wash conditions
Functional assignment conflictsEpistasis analysisDouble/triple mutants with known pathway components

The search results show that D. discoideum responds very differently to various bacteria , suggesting that contradictory results might emerge from subtle variations in experimental conditions.

How can systems biology approaches integrate multiple data types to understand DDB_G0283731 function?

Systems biology approaches can integrate diverse data types:

Integration ApproachMethodologyOutcome for DDB_G0283731
Multi-omics integrationJoint pathway analysis of transcriptomic, proteomic, metabolomic dataComprehensive functional context
Network reconstructionProtein-protein interaction networks, metabolic networksPositioning within cellular pathways
Mathematical modelingOrdinary differential equations, Boolean networksDynamic behavior prediction
Machine learningSupport vector machines, random forestsFunction prediction from complex features
Text miningNatural language processing of literatureIntegration with existing knowledge

For transmembrane proteins like DDB_G0283731, systems approaches are particularly valuable for understanding:

  • Integration in signaling cascades

  • Contribution to complex cellular phenotypes

  • Functional redundancy with related proteins

  • Context-dependent functions

What are the most promising research directions for understanding DDB_G0283731 function?

Based on current knowledge about D. discoideum and bacterial interactions:

Research DirectionApproachExpected Impact
Bacterial recognitionDDB_G0283731 localization during bacterial challenge Role in pathogen sensing
Signal transductionPhosphoproteomics after bacterial exposurePositioning in signaling pathways
Transcriptional regulationRNA-seq of knockout vs. wild-type Downstream effects
Structure-function analysisMutagenesis of predicted functional domainsMechanistic insights
In vivo significanceBacterial survival/competition assays Ecological role

The search results highlight the specificity of D. discoideum's response to different bacteria , suggesting that DDB_G0283731 might have highly specific functions in bacterial recognition or response pathways.

How can contradictions between in vitro and in vivo findings be resolved?

To address potential discrepancies between in vitro and in vivo results:

Contradiction TypeResolution StrategyImplementation
Binding affinitiesMembrane context reconstitutionNative-like lipid compositions
Protein interactionsIn-cell validation methodsFRET, BiFC, PLA in living cells
Functional significancePhysiologically relevant conditionsNatural bacterial strains, appropriate densities
Signaling outcomesTemporal resolution of eventsTime-course experiments with multiple readouts
Phenotypic effectsMicroenvironmental considerationsCo-culture systems mimicking natural habitats

The search results emphasize the importance of experimental conditions, showing that even the choice of medium and incubation time can significantly affect D. discoideum's response to bacteria .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.