Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0285607 (DDB_G0285607)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0285607; Uncharacterized transmembrane protein DDB_G0285607
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-361
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0285607
Target Protein Sequence
MDFTSSKSVSLFETSLLKENQFQQPQQQPSSPIKPIKPILKLVVNSNKKYNNKNISNNNN NNNNNNNNVCGNINNNNELGDQSDIERSFLINNFEGSDQLTNPYYNSIDIESIIIEVYSN QFSKLNCDFQGLISSKSKILNSNNFSSDYNYNNYNNNNNNNNNNNNNNNNNNNNNNNNNN NNNNKNNNKNNNNKPNNFIHHHHHHHHYHHYHNHHKVENLIDSHIFIGLMAFLILFILMV IGLLIYKYNLKKRVLILLEKRYQRKKKVKTSQFGDDFTSAKFSQVFPKNLNINQKNKDDG DDSSGADDLSVGGESFDGESDFEHFKEVQVVGDIDNVFFFKNNNYYYEENFDNENLINKE F
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the optimal expression system for recombinant DDB_G0285607 protein production?

The optimal expression system depends on your specific research needs. E. coli is the most commonly used system for DDB_G0285607 expression due to its simplicity and cost-effectiveness. According to comparative studies, E. coli-based expression systems provide good yields of functional protein when properly optimized.

To maximize expression efficiency in E. coli:

  • Balance vector copy number with promoter strength to minimize metabolic burden

  • Consider using p15A ori (10 copies/cell) instead of high-copy pMB1' ori (500-700 copies/cell) when protein toxicity is a concern

  • Select an appropriate promoter system based on experimental requirements (T7 for high expression, lac for moderate control)

Expression yields can vary significantly based on the vector design:

Expression SystemVector ComponentsTypical YieldAdvantages
E. coli BL21(DE3)T7 promoter + His tag3-5 mg/LHigh expression, simple purification
E. coli BL21Lac promoter + His tag1-3 mg/LBetter control, less inclusion bodies
Pichia pastorisAOX1 promoter10-50 mg/LBetter folding for complex proteins

When working with DDB_G0285607, note that the standard recombinant protein (Cat.No. RFL31572DF) is expressed in E. coli with an N-terminal His tag covering the full-length protein (1-361 amino acids) .

What are the optimal storage conditions for recombinant DDB_G0285607?

Recombinant DDB_G0285607 requires specific storage conditions to maintain stability and activity. The protein is typically supplied as a lyophilized powder and should be stored at -20°C upon receipt. For long-term storage, consider the following protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% (recommended range: 5-50%)

  • Aliquot to prevent repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

The storage buffer composition is critical for stability:

Buffer ComponentConcentrationPurpose
Tris/PBSpH 8.0Maintains protein structure
Trehalose6%Prevents denaturation during freeze-thaw

Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided .

What experimental approaches are recommended for studying the lateral diffusion of DDB_G0285607 in Dictyostelium cell membranes?

To effectively study lateral diffusion of DDB_G0285607 in Dictyostelium cell membranes, a single-molecule tracking approach has proven most effective. A comprehensive methodology includes:

  • Protein tagging: Express DDB_G0285607 with HaloTag at the C-terminus for single-molecule imaging

  • Labeling: Stain with fluorescent Halo-ligand conjugated to tetramethylrhodamine

  • Imaging system: Total internal reflection fluorescence microscopy (TIRFM) with image acquisition at 30 frames/s

  • Analysis pipeline:

    • Extract single-molecule trajectories

    • Calculate mean square displacement (MSD)

    • Apply hidden Markov model (HMM) for multiple diffusion states analysis

Research has demonstrated that transmembrane proteins in Dictyostelium typically exhibit three distinct diffusion states regardless of their structural properties:

Diffusion StateDiffusion Coefficient Range (μm²/s)Characteristics
Fast0.025-0.033Free diffusion in fluid regions
Medium0.010-0.020Intermediate viscosity regions
Slow0.001-0.005High viscosity microdomains

The lateral mobility of DDB_G0285607 is likely governed by membrane viscosity rather than protein size, as demonstrated by studies showing that diffusion coefficients of various transmembrane proteins in Dictyostelium follow the Saffman-Delbrück model .

What genetic manipulation techniques are most effective for studying DDB_G0285607 function in Dictyostelium discoideum?

For functional characterization of DDB_G0285607 in Dictyostelium, several genetic approaches have proven effective:

  • Gene knockout: Using CRISPR-Cas9 or homologous recombination

  • Gene knockdown: Using RNAi or antisense strategies

  • Expression of tagged versions: For localization and interaction studies

  • Rescue experiments: Reintroducing wild-type or mutant versions

For transformation of Dictyostelium with DDB_G0285607 constructs, the electroporation method yields optimal efficiency:

Optimized electroporation protocol:

  • Grow 10^7 cells in a Petri dish

  • Wash with development buffer (DB: 5 mM NaH₂PO₄, 5 mM Na₂HPO₄, 2 mM MgSO₄, 0.2 mM CaCl₂)

  • Collect cells in electroporation buffer (10 mM KH₂PO₄, 50 mM Sucrose)

  • Mix 400 μl cell suspension with 5 μg plasmid DNA

  • Electroporate at 500 V, 100 μs pulse width, 1.0 s interval, 15 pulses

  • Transfer to Petri dish with 4 μl healing buffer (100 mM CaCl₂, 100 mM MgCl₂)

  • After 15 min, add HL5 buffer and medium

  • Select transformants with G418 (10 μg/ml) after 24h

For stable expression, vectors containing G418 resistance markers achieve approximately 70-80% transformation efficiency when targeting the DDB_G0285607 locus .

How can I develop specific antibodies against DDB_G0285607 for immunolocalization studies?

Developing specific antibodies against DDB_G0285607 requires specialized approaches due to the typically low immunogenicity of transmembrane proteins. A recommended workflow combines both hybridoma sequencing and phage display techniques:

  • Antigen preparation:

    • Express recombinant fragments of hydrophilic regions of DDB_G0285607

    • Use synthetic peptides from predicted extracellular loops

    • Consider KLH-conjugated peptides for improved immunogenicity

  • Antibody generation:

    • Primary screening by ELISA against recombinant protein

    • Secondary validation by Western blotting and immunofluorescence

    • Sequence validated hybridomas to generate recombinant versions

The phage display approach has shown particular success for Dictyostelium proteins:

Antibody FormatAdvantagesApplications
scFvSmall size, tissue penetrationImaging, FACS
FabMedium size, stableWestern blot, IP
IgGHigh avidity, long half-lifeAll applications

For reliable immunolocalization results, validate antibodies using both wild-type and knockout/knockdown cells to confirm specificity. Recent studies have demonstrated that recombinant antibodies (rAbs) provide more consistent results than traditional hybridoma-derived antibodies for Dictyostelium studies .

What experimental design is recommended for investigating the metabolic burden of DDB_G0285607 expression in heterologous systems?

To effectively investigate the metabolic burden associated with DDB_G0285607 expression, a systematic experimental design approach is essential:

  • Vector design variation:

    • Construct expression vectors with different replication origins (p15A vs. pMB1')

    • Test multiple promoter systems (T7, lac, tac) with varying strengths

    • Include appropriate controls (empty vector, non-toxic protein)

  • Expression monitoring:

    • Cell growth curves comparing pre- and post-induction

    • Metabolite analysis (glucose consumption, acetate production)

    • Protein synthesis rate and quality assessment

A comprehensive experimental design includes the following variables:

Independent VariableLevels to TestMeasurements (Dependent Variables)
Vector copy numberLow (p15A, ~10 copies) vs. High (pMB1', 500-700 copies)Growth rate, final OD, protein yield
Promoter strengthT7 (strong), lac (moderate), tac (intermediate)Transcript levels, protein accumulation
Induction conditionsTemperature, inducer concentration, timeSoluble vs. insoluble protein ratio
Host strainBL21(DE3), BL21, RosettaCodon optimization effects

Research has shown that balancing vector copy number and promoter strength is crucial to minimize metabolic burden while maximizing protein yield. For transmembrane proteins like DDB_G0285607, lower copy number vectors often provide better results due to reduced toxicity .

How does the membrane environment affect DDB_G0285607 function and mobility in Dictyostelium cells?

The membrane environment significantly impacts both function and mobility of DDB_G0285607 in Dictyostelium. Current research indicates:

  • Membrane viscosity influence:

    • Transmembrane proteins adopt three distinct mobility states corresponding to membrane regions with different viscosities

    • These states show diffusion coefficients ranging from 0.001 to 0.033 μm²/s

    • The relationship between protein size and diffusion follows the Saffman-Delbrück model

  • Cytoskeletal interactions:

    • Inhibition of microtubule dynamics reduces protein mobility

    • Actin cytoskeleton disruption alters diffusion patterns

    • Myosin II activity affects protein distribution

  • Membrane domain formation:

    • Specialized membrane regions may concentrate specific transmembrane proteins

    • During processes like receptor capping, proteins redistribute on the membrane surface

    • Post-translational modifications (phosphorylation, methylation) can change during redistribution

Experimental evidence suggests that transmembrane proteins in Dictyostelium exhibit different behavior compared to their counterparts in higher eukaryotes, with simpler diffusion patterns that are more dependent on membrane environment than protein structure .

To study these effects, researchers can:

  • Track protein movement using single-molecule imaging

  • Manipulate membrane composition with specific inhibitors

  • Compare wild-type behavior with cytoskeletal mutants

What are the challenges and solutions for structural studies of DDB_G0285607?

Structural characterization of transmembrane proteins like DDB_G0285607 presents significant challenges due to their hydrophobic nature and membrane integration. A comprehensive approach includes:

  • Protein preparation challenges:

    • Difficulty in obtaining sufficient quantities of properly folded protein

    • Membrane extraction while maintaining native structure

    • Protein stability during purification and crystallization

  • Recommended solutions:

    • Truncation strategies to focus on soluble domains

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

    • Detergent screening for optimal solubilization

    • Lipid cubic phase crystallization for intact protein

For cryo-EM studies, consider:

  • Reconstitution in nanodiscs or amphipols

  • Direct extraction from native membranes using styrene-maleic acid copolymers

  • Grid optimization to prevent preferential orientation

While no high-resolution structure of DDB_G0285607 has been reported, recent advances in membrane protein structural biology suggest a multi-technique approach combining X-ray crystallography, cryo-EM, and NMR for comprehensive structural characterization.

How can DDB_G0285607 be utilized in the study of Dictyostelium as a model for neurological disorders?

DDB_G0285607 can serve as a valuable tool in studying Dictyostelium as a model for neurological disorders through several experimental approaches:

  • Functional homology assessment:

    • Bioinformatic analysis for structural similarities with human neurological proteins

    • Complementation studies with human orthologs in knockout strains

    • Phenotypic analysis of mutants for neurological disease-related characteristics

  • Experimental design strategy:

    • Generate knockout or knockdown DDB_G0285607 strains

    • Compare cellular phenotypes with known neurological disease models

    • Express human disease proteins in Dictyostelium background

    • Analyze membrane protein trafficking and localization

Dictyostelium has proven valuable for studying proteins implicated in neurological disorders:

Neurological DisorderDictyostelium AdvantageRelevant Cellular Processes
Alzheimer's diseaseγ-secretase complex analysisProtein processing, autophagy
Parkinson's diseaseα-synuclein expression studiesProtein aggregation, trafficking
Neuronal ceroid lipofuscinosesLysosomal function analysisAutophagy, protein degradation
LissencephalyCytoskeletal protein studiesCell migration, development

When utilizing DDB_G0285607 in these studies, focus on its potential role in membrane protein trafficking, signaling, or cytoskeletal interactions that might parallel neurological disease mechanisms in humans .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.