Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0287341 (DDB_G0287341)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You may use this as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type preference, please specify it, and we will prioritize its inclusion in the manufacturing process.
Synonyms
DDB_G0287341; Uncharacterized transmembrane protein DDB_G0287341
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0287341
Target Protein Sequence
MNSLKFKLTFYTLFGLIWSLLVFFFLSPWYEETLKKDIFELKQYKFSNFLILYDKIEYNK FDYVDGAETYFRDAFGFETKTLEGIMTSIKVLSTLAFLSTTFLIYFTIIFYVHIKFIFDT ENHRRLGKKVWCYVLIGSPLVSFFLSFITLFLIIGIPSAVRNDCYKEYGKKFCNSQLRYH TSFIGENQVWLWGPSRGWIILMVDTILTFFATIYCWRNAHKFDEVKMKKKKKNYLNNNNN KNNIL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are currently used to produce recombinant DDB_G0287341?

Recombinant DDB_G0287341 is primarily produced using E. coli expression systems. According to available product information, the full-length protein (amino acids 1-245) is expressed with affinity tags to facilitate purification, with His-tag being commonly used .

To express this protein:

  • The gene encoding DDB_G0287341 is cloned into appropriate expression vectors

  • The construct is transformed into E. coli host cells

  • Expression is induced under optimized conditions

  • The protein is purified using affinity chromatography based on the His-tag

This bacterial expression system is preferred for its cost-effectiveness and high yield, though researchers should be aware that post-translational modifications present in the native Dictyostelium protein would not be replicated in the E. coli system .

What are the recommended storage conditions for recombinant DDB_G0287341?

The optimal storage conditions for recombinant DDB_G0287341 are:

Storage PeriodRecommended TemperatureBuffer Composition
Long-term-20°C to -80°CTris-based buffer with 50% glycerol
Working stock4°CSame as above
Maximum duration at 4°CUp to one weekSame as above

It's important to note that repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity. For extended experiments, it's advisable to prepare small working aliquots to minimize freeze-thaw cycles .

What are the optimal buffer conditions for functional studies with DDB_G0287341?

When designing functional assays for DDB_G0287341, researchers should consider buffer systems that maintain the native conformation of this transmembrane protein. Based on standard protocols for Dictyostelium proteins:

  • For chemotaxis or cellular function studies: KK2 buffer (16.5 mM KH₂PO₄, 3.8 mM K₂HPO₄, pH 6.2) is often used as it mimics the physiological environment of Dictyostelium .

  • For in vitro biochemical assays: A Tris-based buffer system with appropriate ionic strength (typically 20-50 mM Tris-HCl, 100-150 mM NaCl, pH 7.4) supplemented with mild detergents (0.1% DDM or 0.05% LMNG) helps maintain the structural integrity of the transmembrane domains.

  • Consider adding protease inhibitors to prevent degradation during extended experiments.

The specific functional assays should be designed based on predicted protein characteristics, with careful attention to maintaining membrane protein stability throughout the experimental procedures .

How can I design knockout experiments to study the function of DDB_G0287341 in Dictyostelium?

Designing knockout experiments for DDB_G0287341 leverages the advantages of Dictyostelium as a haploid organism, making gene disruption strategies more straightforward than in diploid systems. A methodological approach would include:

  • Design Strategy:

    • Homologous recombination approach: Create a knockout construct with a selection marker (typically blasticidin resistance) flanked by ~500-1000 bp sequences homologous to the 5' and 3' regions of the DDB_G0287341 gene.

    • CRISPR-Cas9 approach: Design guide RNAs targeting the early coding sequence of DDB_G0287341 along with a donor DNA containing a selection marker.

  • Transformation:

    • Use electroporation to introduce the knockout construct into Dictyostelium cells.

    • Culture cells in medium containing the appropriate selection antibiotic.

  • Screening and Validation:

    • Perform PCR-based screening to identify successful knockout clones.

    • Validate knockouts by Western blotting or RT-PCR to confirm the absence of DDB_G0287341 expression.

  • Phenotypic Analysis:

    • Since Dictyostelium has distinct growth and developmental phases, assess phenotypes in both contexts.

    • Examine growth rate, cell morphology, and cellular processes like endocytosis during the unicellular phase.

    • Analyze development by inducing starvation and observing aggregation, chemotaxis toward cAMP, and fruiting body formation .

The haploid nature of Dictyostelium makes it particularly amenable to genetic manipulations, providing a powerful system to investigate the function of uncharacterized proteins like DDB_G0287341 .

What approaches can be used to determine the subcellular localization of DDB_G0287341?

Determining the subcellular localization of DDB_G0287341 requires combining molecular biology techniques with imaging approaches:

  • Fluorescent Protein Fusion:

    • Create C-terminal and N-terminal GFP (or other fluorescent protein) fusions of DDB_G0287341

    • Express these constructs in Dictyostelium cells using available expression vectors

    • Consider using inducible promoters to control expression levels

  • Immunofluorescence:

    • Generate specific antibodies against DDB_G0287341 or use antibodies against the His-tag in the recombinant protein

    • Fix and permeabilize cells appropriately for transmembrane protein detection

    • Use membrane-specific counterstains to confirm transmembrane localization

  • Subcellular Fractionation:

    • Separate cellular components through differential centrifugation

    • Analyze fractions by Western blotting to detect DDB_G0287341

    • Compare with known markers for different cellular compartments

  • Visualization and Analysis:

    • Use confocal microscopy for high-resolution imaging

    • Perform colocalization studies with markers for different membrane compartments (plasma membrane, endosomes, Golgi, etc.)

    • Consider time-lapse imaging during different cellular processes, particularly during chemotaxis and development

Since many transmembrane proteins in Dictyostelium are dynamically regulated during development and chemotaxis, examining localization under different conditions (growth, starvation, cAMP stimulation) would provide valuable insights into potential functions .

How might DDB_G0287341 be involved in Dictyostelium chemotaxis pathways?

Investigating the potential role of DDB_G0287341 in chemotaxis requires understanding the chemotactic machinery of Dictyostelium and designing experiments to test specific hypotheses:

  • Background Analysis:

    • Transmembrane proteins often function as receptors or signal transducers in chemotaxis

    • The amino acid sequence of DDB_G0287341 should be analyzed for potential binding domains or signaling motifs

    • Bioinformatic analyses can predict if it shares structural similarities with known chemotaxis components

  • Experimental Approaches:

    • Generate DDB_G0287341 knockout strains and assess their chemotactic response using standard assays

    • The agar-based chemotaxis assay described in the literature can be adapted:

      • Place cells at varying distances (3-6 mm) from wells containing different concentrations of chemoattractants (cAMP or folic acid)

      • Observe and quantify directional movement toward the chemoattractant

    • Compare responses to both cAMP (developmental chemoattractant) and folic acid (vegetative chemoattractant)

  • Molecular Pathway Analysis:

    • Examine if DDB_G0287341 expression changes during development or starvation

    • Test if knockout affects known components of chemotaxis pathways (cAR receptors, G-proteins, cGMP production)

    • Investigate protein-protein interactions using co-immunoprecipitation with tagged DDB_G0287341

If DDB_G0287341 is involved in chemotaxis, knockout strains might show altered sensitivity to chemoattractants or defects in gradient sensing, directional movement, or signal relay. These phenotypes would be particularly evident during the aggregation phase of development, which depends heavily on chemotaxis toward cAMP .

What comparative genomics approaches can reveal potential functions of DDB_G0287341?

Leveraging comparative genomics provides valuable insights into uncharacterized proteins by examining evolutionary relationships and conserved features:

  • Homology Identification:

    • Perform BLAST searches against various genomic databases to identify homologs in other species

    • Focus particularly on other Dictyostelids and related amoebae to identify closest relatives

    • Look for homologs in higher organisms, which might have better-characterized functions

  • Domain and Motif Analysis:

    • Use tools like PFAM, PROSITE, and InterPro to identify conserved domains and motifs

    • Analyze transmembrane topology predictions across homologs to identify conserved structural features

    • Examine conservation patterns in the cytoplasmic versus extracellular domains, which might suggest functional interactions

  • Evolutionary Analysis:

    • Construct phylogenetic trees to understand the evolutionary history of DDB_G0287341

    • Identify patterns of selection (positive, negative) acting on different regions of the protein

    • Map conserved residues onto predicted structural models to identify potentially functional sites

  • Integration with Functional Data:

    • Cross-reference with available transcriptomic data from different developmental stages

    • Analyze co-expression patterns with genes of known function

    • Examine synteny (conservation of gene order) across species, which might suggest functional associations

This comparative approach could reveal whether DDB_G0287341 belongs to a known protein family with characterized functions or represents a novel class of proteins specific to Dictyostelium or related organisms .

How can proteomics approaches be used to identify interaction partners of DDB_G0287341?

Identifying protein interaction partners is crucial for understanding the function of uncharacterized proteins like DDB_G0287341. A comprehensive proteomics strategy would include:

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Express tagged versions of DDB_G0287341 (His-tag, FLAG-tag, or biotin tag) in Dictyostelium

    • Carefully solubilize membranes using appropriate detergents to maintain protein-protein interactions

    • Perform affinity purification followed by mass spectrometry to identify co-purifying proteins

    • Include appropriate controls (empty vector, unrelated membrane protein) to filter out non-specific interactions

  • Proximity Labeling Approaches:

    • Generate BioID or TurboID fusions of DDB_G0287341

    • These enzymes biotinylate proteins in close proximity to DDB_G0287341 in living cells

    • Purify biotinylated proteins and identify them by mass spectrometry

    • This approach is particularly valuable for transmembrane proteins as it can capture transient interactions

  • Cross-linking Mass Spectrometry:

    • Treat cells expressing DDB_G0287341 with membrane-permeable crosslinkers

    • Purify DDB_G0287341 complexes and analyze by mass spectrometry

    • This can capture direct interaction partners and provide information about interaction interfaces

  • Functional Validation:

    • Confirm key interactions using reciprocal co-immunoprecipitation

    • Perform co-localization studies using fluorescence microscopy

    • Test functional relationships by gene knockout or knockdown of interaction partners

Given that DDB_G0287341 is a transmembrane protein, special attention must be given to membrane solubilization conditions that preserve native interactions while efficiently extracting the protein from the membrane environment .

What are common challenges in working with recombinant transmembrane proteins like DDB_G0287341 and how can they be addressed?

Working with transmembrane proteins presents several technical challenges that require specific methodological solutions:

  • Protein Solubility and Aggregation:

    • Challenge: Transmembrane domains tend to cause aggregation during expression and purification

    • Solutions:

      • Optimize detergent selection (try DDM, LMNG, or Brij-35)

      • Use fusion partners that enhance solubility (MBP, SUMO)

      • Consider stepwise extraction protocols with increasing detergent concentrations

  • Maintaining Native Conformation:

    • Challenge: Detergents can disrupt protein structure and function

    • Solutions:

      • Screen multiple detergent types and concentrations

      • Try amphipols or nanodiscs for functional studies

      • Include lipids from Dictyostelium membranes during purification

  • Low Expression Levels:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solutions:

      • Test different expression conditions (temperature, induction time, media)

      • Consider specialized expression strains (C41/C43 for E. coli)

      • Explore alternative expression systems (insect cells, cell-free systems)

  • Functional Assay Development:

    • Challenge: Difficult to establish activity assays for uncharacterized proteins

    • Solutions:

      • Test binding to potential ligands using thermal shift assays

      • Examine effects on known Dictyostelium signaling pathways when expressed

      • Develop proteoliposome-based assays to test transport or signaling functions

For DDB_G0287341 specifically, maintaining proper transmembrane domain folding will be crucial for any functional characterization, as these domains likely play essential roles in the protein's native function .

How can contradictory results in DDB_G0287341 knockout studies be resolved?

When faced with contradictory results in gene knockout studies, a systematic troubleshooting approach is essential:

  • Validate Knockout Efficiency:

    • Confirm the complete absence of the protein using multiple methods (Western blot, RT-PCR)

    • Sequence the genomic locus to verify the expected modification

    • Check for potential truncated proteins or alternative splicing products

  • Control for Genetic Background Effects:

    • Generate multiple independent knockout clones

    • Compare phenotypes across all clones to distinguish clone-specific from gene-specific effects

    • Consider creating knockouts in different Dictyostelium strains to test strain dependence

  • Address Potential Compensatory Mechanisms:

    • Look for upregulation of related genes that might compensate for loss of DDB_G0287341

    • Perform RNA-seq on knockout strains to identify altered gene expression

    • Consider creating acute knockdowns (inducible systems or RNAi) to bypass compensation

  • Standardize Experimental Conditions:

    • Ensure consistent cell density, starvation times, and buffer compositions across experiments

    • Control environmental factors (temperature, pH, plate composition)

    • For chemotaxis experiments, standardize chemoattractant concentrations and gradient establishment

  • Rescue Experiments:

    • Reintroduce wild-type DDB_G0287341 to confirm phenotype reversal

    • Use inducible expression systems to control rescue timing and expression levels

    • Introduce mutated versions to identify critical functional domains

In Dictyostelium research, developmental timing can be particularly critical - phenotypes may only be apparent at specific stages or under specific conditions (e.g., different starvation times can dramatically affect chemotactic responses to cAMP) .

What quantitative approaches can be used to analyze DDB_G0287341's potential role in development and chemotaxis?

Rigorous quantitative analysis is essential for characterizing subtle phenotypes associated with DDB_G0287341:

  • Automated Cell Tracking for Chemotaxis:

    • Use time-lapse microscopy to record cell movement

    • Apply tracking algorithms to quantify:

      • Directionality (cosine of the angle between movement direction and gradient)

      • Speed (μm/min)

      • Persistence (ratio of displacement to total path length)

      • Chemotactic index (CI = distance moved in gradient direction / total distance moved)

    • Compare these parameters between wild-type and DDB_G0287341 knockout cells

  • Developmental Timing Analysis:

    • Document development using time-lapse imaging

    • Quantify timing of key morphological transitions:

      • Time to aggregation

      • Mound formation

      • Slug migration

      • Culmination and fruiting body formation

    • Measure the size and shape of multicellular structures at each stage

  • Molecular Response Quantification:

    • Measure cAMP-induced responses using live cell reporters:

      • cAMP production (using FRET-based sensors)

      • cGMP levels (using immunoassays)

      • Cytoskeletal dynamics (using fluorescent actin reporters)

    • Quantify the amplitude and kinetics of these responses

  • Statistical Analysis:

    • Apply appropriate statistical tests for comparing quantitative data

    • Consider using mixed-effects models to account for experiment-to-experiment variation

    • Present data with clear indications of sample size, statistical significance, and effect size

Sample data presentation format for chemotaxis analysis:

ParameterWild-typeDDB_G0287341 KOp-value
Speed (μm/min)12.3 ± 0.710.1 ± 0.90.03
Directionality0.92 ± 0.050.61 ± 0.120.002
CI0.78 ± 0.060.45 ± 0.08<0.001

These quantitative approaches would reveal whether DDB_G0287341 affects specific aspects of cell movement, development, or signal transduction pathways in Dictyostelium .

How might DDB_G0287341 research contribute to broader understanding of transmembrane protein evolution?

Research on DDB_G0287341 presents unique opportunities to advance our understanding of transmembrane protein evolution:

  • Evolutionary Origin Analysis:

    • Dictyostelium occupies an interesting evolutionary position, having diverged after plants but before fungi and animals

    • Determining whether DDB_G0287341 represents an ancestral or derived protein could provide insights into transmembrane protein evolution

    • Comprehensive phylogenetic analyses across diverse eukaryotic lineages can reveal patterns of conservation and innovation

  • Structural-Functional Relationships:

    • Mapping sequence conservation onto predicted structural features can reveal evolutionary constraints

    • Identifying rapidly evolving versus conserved regions might indicate functional specialization

    • Comparative analysis of transmembrane topology across homologs can reveal evolutionary patterns in membrane protein architecture

  • Adaptive Evolution Assessment:

    • Calculate dN/dS ratios to identify signatures of positive or purifying selection

    • Compare these patterns across different taxonomic groups containing DDB_G0287341 homologs

    • Connect evolutionary patterns to ecological or physiological adaptations in different amoebozoan species

  • Horizontal Gene Transfer Investigation:

    • Assess whether there's evidence for horizontal gene transfer events involving this gene

    • Unusual phylogenetic distribution could suggest ancient transfer events

    • This could provide insights into the evolution of transmembrane proteomes across distantly related organisms

This evolutionary perspective would not only illuminate the history of DDB_G0287341 but could also generate hypotheses about its function based on its evolutionary trajectory and the selection pressures that have shaped it .

What advanced imaging techniques would be most informative for studying DDB_G0287341 dynamics during chemotaxis?

Advanced imaging approaches can provide unprecedented insights into the dynamics and function of DDB_G0287341 during complex cellular processes like chemotaxis:

  • Super-Resolution Microscopy:

    • Techniques like PALM, STORM, or STED can resolve protein localization at nanometer scale

    • Apply these to visualize DDB_G0287341 clustering or interactions with other proteins

    • Compare localization patterns between the leading and trailing edges during chemotaxis

  • Single-Molecule Tracking:

    • Label DDB_G0287341 sparsely with photoactivatable fluorophores

    • Track individual molecules to determine diffusion characteristics

    • Analyze if mobility changes during chemotactic stimulation

    • Calculate residence times in different cellular compartments

  • FRET/FLIM Applications:

    • Design FRET pairs to detect conformational changes in DDB_G0287341

    • Use FRET to identify proximity to known chemotaxis components

    • Fluorescence lifetime imaging (FLIM) can provide quantitative interaction data

  • Lattice Light-Sheet Microscopy:

    • This technique enables high-speed 3D imaging with minimal phototoxicity

    • Particularly valuable for tracking dynamic processes during chemotaxis

    • Can reveal rapid redistribution of proteins during directional changes

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence imaging of tagged DDB_G0287341 with electron microscopy

    • Provides ultrastructural context for protein localization

    • Especially valuable for detailed membrane localization studies

These advanced imaging approaches would be particularly informative if combined with experimental manipulations such as acute chemotactic stimulation, cytoskeletal disruption, or genetic perturbations of known chemotaxis pathways .

How can systems biology approaches integrate DDB_G0287341 into broader signaling networks in Dictyostelium?

Systems biology offers powerful frameworks to understand how individual proteins like DDB_G0287341 function within larger cellular networks:

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data from wild-type and DDB_G0287341 knockout cells

    • Identify differentially expressed genes, proteins, and metabolites

    • Construct network models that place DDB_G0287341 in the context of global cellular responses

    • Example data integration approach:

Data TypeWild-type vs. DDB_G0287341 KOPathway Enrichment
Transcriptomics128 genes differentially expressedChemotaxis, membrane trafficking
Proteomics56 proteins altered in abundancecAMP signaling, actin regulation
Phosphoproteomics23 sites differentially phosphorylatedG-protein signaling, MAPK cascade
  • Network Analysis:

    • Construct protein-protein interaction networks centered on DDB_G0287341

    • Apply algorithms to identify network modules and potential functional associations

    • Calculate network metrics (betweenness centrality, clustering coefficient) to predict functional importance

    • Visualize networks to identify hub proteins and potential regulatory relationships

  • Dynamic Modeling:

    • Develop mathematical models of relevant pathways (e.g., chemotaxis signaling)

    • Incorporate DDB_G0287341 based on experimental data

    • Use ordinary differential equations to simulate system behavior

    • Test predictions through targeted experiments

    • Refine models based on new data in an iterative process

  • Comparative Systems Analysis:

    • Compare network structures between Dictyostelium and other organisms

    • Identify conserved modules that might share DDB_G0287341 homologs

    • Use this to infer potential functions based on network context

This systems-level integration would place DDB_G0287341 within the broader context of Dictyostelium signaling and development, potentially revealing unexpected functional connections and generating testable hypotheses about its biological role .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.