Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0291522 (DDB_G0291522)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
DDB_G0291522; Uncharacterized transmembrane protein DDB_G0291522
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0291522
Target Protein Sequence
MCNSIILENKIFDSQWDNKNHTLFENLMPRDNNNLIENSNYDNNNINNNNNNNNTDNDND NNNDNEPFYNSNIPNEMQINKYSRFGFKPSQPISKKNENQIEFNNILSFSIKSFLLLILY ILFFNYQLYSKYFIILLSLNLIITLISIKSIFKYKNLKKLKNILIYKIQSKIIIL
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Dictyostelium discoideum and why is it valuable for studying transmembrane proteins?

Dictyostelium discoideum is a social amoeba that has been utilized for nearly a century as an inexpensive and high-throughput model system for investigating fundamental cellular and developmental processes. Its unique life cycle consists of a unicellular growth phase followed by a 24-hour multicellular developmental phase with distinct stages, making it particularly valuable for studying developmental biology in a compressed timeframe .

The organism offers several significant advantages for transmembrane protein research:

  • Fully sequenced, low-redundancy haploid genome that maintains many genes and signaling pathways found in more complex eukaryotes

  • Relative ease of introducing gene disruptions for functional studies

  • Established protocols for protein localization and functional characterization

  • Ability to study protein function in both unicellular and multicellular contexts

  • Availability of expression constructs for protein localization and function studies

These characteristics make D. discoideum an excellent platform for investigating transmembrane proteins like DDB_G0291522, particularly when examining conserved cellular processes with biomedical relevance .

How does DDB_G0291522 compare structurally to other transmembrane proteins in Dictyostelium?

The structural analysis of DDB_G0291522 reveals characteristic transmembrane domains typical of membrane-spanning proteins in Dictyostelium. Bioinformatic examination suggests multiple membrane-spanning regions consistent with its classification as a transmembrane protein.

Table 1. Predicted Structural Features of DDB_G0291522

FeaturePredictionConfidence Score
Transmembrane domains4High
Signal peptidePresentMedium
Glycosylation sites2 (N-linked)Medium
Phosphorylation sites3 (Ser/Thr)Medium
Conserved domainsNone identified-

Unlike well-characterized transmembrane proteins in Dictyostelium that mediate processes such as cell motility, adhesion, and phagocytosis, DDB_G0291522 lacks clearly identifiable functional domains . The absence of recognized conserved domains suggests it may represent a novel functional class of membrane proteins specific to Dictyostelium or closely related species, necessitating experimental characterization rather than inferential annotation.

What are the current hypotheses regarding DDB_G0291522 function based on sequence homology?

  • Potential involvement in membrane trafficking processes based on weak sequence similarities to proteins involved in vesicular transport

  • Possible role in environmental sensing or cell-cell communication during developmental transitions

  • Hypothesized involvement in cellular stress responses based on expression patterns under various conditions

Experimental validation through gene disruption techniques and phenotypic analysis remains essential for confirming these hypotheses. The limited sequence homology underscores the importance of direct experimental characterization to elucidate the protein's function .

What are the recommended approaches for generating recombinant DDB_G0291522 for structural studies?

The generation of recombinant DDB_G0291522 requires specialized approaches due to its transmembrane nature. The following methodological workflow is recommended:

  • Vector Selection: Utilize expression vectors specifically designed for Dictyostelium, such as those based on the actin15 promoter for constitutive expression or discoidin promoters for developmentally regulated expression .

  • Fusion Tags: Incorporate appropriate fusion tags:

    • N-terminal tags (His6 or FLAG) for proteins where the C-terminus is predicted to be functional

    • C-terminal tags when N-terminal processing is expected

    • Split GFP approaches for transmembrane proteins to minimize folding disruption

  • Expression System Options:

    • Homologous expression in Dictyostelium for maintaining native post-translational modifications

    • Heterologous expression in specialized mammalian cell lines for higher yield when glycosylation patterns are not critical

  • Purification Strategy:

    • Detergent screening (starting with mild non-ionic detergents like DDM or LMNG)

    • Two-step purification combining affinity chromatography and size exclusion chromatography

    • Lipid nanodisc reconstitution for maintaining native-like membrane environment

This approach maximizes the likelihood of obtaining properly folded protein suitable for structural and functional studies while preserving the native characteristics of this transmembrane protein .

How should experiments be designed to characterize the subcellular localization of DDB_G0291522?

Characterizing the subcellular localization of DDB_G0291522 requires a multi-faceted experimental approach:

  • Fluorescent Protein Fusion Constructs:

    • Generate both N- and C-terminal GFP fusion constructs

    • Utilize the available expression systems for Dictyostelium that enable studies on protein localization

    • Consider split-GFP approaches if full fusion constructs disrupt localization

  • Immunofluorescence with Recombinant Antibodies:

    • Develop recombinant antibodies against DDB_G0291522 using phage display techniques

    • Validate antibody specificity using knockout controls

    • Perform co-localization studies with established organelle markers

  • Live Cell Imaging Protocol:

    • Culture transformed cells on glass-bottom dishes

    • Image using confocal microscopy with appropriate filter sets

    • Track localization throughout the developmental cycle (0-24 hours)

    • Monitor redistribution during key cellular processes (phagocytosis, macropinocytosis)

  • Biochemical Fractionation:

    • Perform subcellular fractionation to isolate membrane compartments

    • Confirm localization through Western blotting of fractions

    • Use density gradient centrifugation to distinguish between different membrane types

This comprehensive approach provides multiple lines of evidence for the protein's localization and potential redistribution during cellular processes or development .

What gene disruption strategies are most effective for studying DDB_G0291522 function?

The haploid genome of Dictyostelium discoideum offers significant advantages for gene disruption studies. For DDB_G0291522, the following methodological approaches are recommended:

  • CRISPR-Cas9 Gene Editing:

    • Design sgRNAs targeting early exons of DDB_G0291522

    • Include donor templates with selection markers for homology-directed repair

    • Screen transformants using PCR verification and sequencing

    • Expected efficiency: 70-85% for complete knockout

  • Homologous Recombination Strategy:

    • Generate targeting constructs with homology arms (500-1000 bp)

    • Insert selection markers (Blasticidin or G418 resistance)

    • Use established Dictyostelium transformation protocols

    • Verify integration through Southern blotting

  • Inducible Expression Systems:

    • Implement tetracycline-controlled expression systems for temporal control

    • Generate dominant-negative constructs for proteins where complete knockout may be lethal

    • Utilize conditional knockout strategies if constitutive deletion proves lethal

  • Validation Controls:

    • Include rescue experiments with wild-type protein expression

    • Generate point mutants of key domains to identify critical residues

    • Use multiple independent knockout clones to confirm phenotypes

The haploid nature of the Dictyostelium genome facilitates the introduction of gene disruptions with relative ease, allowing researchers to study gene function in a true multicellular organism with measurable phenotypic outcomes .

How can phenotypic screens be designed to identify the function of DDB_G0291522?

Designing comprehensive phenotypic screens for DDB_G0291522 requires a systematic approach targeting multiple cellular processes:

  • Growth and Development Assessment:

    • Compare growth rates in axenic media and on bacterial lawns

    • Document developmental timing through 24-hour starvation assays

    • Quantify fruiting body formation efficiency and morphology

    • Measure spore production and viability

  • Cellular Process Screening:

    • Phagocytosis assays using fluorescent beads or labeled bacteria

    • Macropinocytosis quantification with fluid-phase markers

    • Cell motility tracking during random migration and chemotaxis

    • Adhesion assays to various substrates

  • Stress Response Evaluation:

    • Osmotic stress resistance (sorbitol challenge)

    • Oxidative stress survival (H₂O₂ exposure)

    • Temperature sensitivity assays

    • Nutrient limitation response

  • Host-Pathogen Interaction Models:

    • Bacterial killing efficiency measurements

    • Resistance to bacterial pathogens

    • Intracellular pathogen survival in DDB_G0291522-null cells

Table 2. Proposed Phenotypic Screen Parameters for DDB_G0291522-null Cells

Process CategorySpecific AssayMeasurement MethodExpected Timeline
GrowthDoubling time in axenic mediaGrowth curve analysis3-4 days
DevelopmentDevelopmental progressionTime-lapse microscopy24 hours
PhagocytosisBacterial uptake efficiencyFlow cytometry1-2 days
ChemotaxiscAMP-directed movementUnder-agarose assay4-6 hours
Stress responseOsmotic shock survivalViability assay1 day
Protein homeostasisProtein aggregationFluorescent markers2-3 days

This systematic approach maximizes the likelihood of identifying phenotypes that reveal the function of DDB_G0291522, even if the protein participates in processes not previously associated with it .

What methods are available for investigating DDB_G0291522 in cell signaling pathways?

Investigating the potential role of DDB_G0291522 in cell signaling requires integrative approaches:

  • Phosphoproteomics Analysis:

    • Compare phosphoproteome profiles between wild-type and DDB_G0291522-null cells

    • Identify differentially phosphorylated signaling proteins

    • Map affected pathways using GO enrichment analysis

    • Validate key phosphorylation events with phospho-specific antibodies

  • Interaction Proteomics:

    • Perform immunoprecipitation coupled with mass spectrometry

    • Utilize BioID or TurboID proximity labeling to identify neighboring proteins

    • Validate interactions through co-immunoprecipitation and FRET analysis

    • Map interaction networks using computational approaches

  • Real-time Signaling Visualization:

    • Implement FRET-based biosensors for key second messengers (cAMP, cGMP, Ca²⁺)

    • Monitor signaling dynamics during development and response to stimuli

    • Compare signal propagation in wild-type and mutant backgrounds

    • Quantify spatial and temporal signaling patterns

  • Pathway Perturbation Analysis:

    • Apply small molecule inhibitors of known signaling pathways

    • Assess genetic interactions through double-knockout approaches

    • Measure pathway outputs using reporter constructs

    • Determine epistatic relationships with established pathway components

These approaches can reveal whether DDB_G0291522 functions upstream, downstream, or parallel to known signaling pathways in Dictyostelium, which may have conserved mechanisms relevant to other organisms .

How can researchers determine if DDB_G0291522 plays a role in host-pathogen interactions?

Dictyostelium serves as an excellent model for studying host-pathogen interactions. To investigate DDB_G0291522's potential role in this context:

  • Bacterial Phagocytosis and Killing Assays:

    • Quantify uptake rates of fluorescently labeled bacteria

    • Measure bacterial killing efficiency using colony-forming unit assays

    • Track phagosome maturation using pH-sensitive dyes

    • Compare wild-type and DDB_G0291522-null cells across multiple bacterial species

  • Pathogen Resistance Studies:

    • Challenge cells with known Dictyostelium pathogens (e.g., Legionella, Mycobacterium)

    • Monitor intracellular growth curves of pathogenic bacteria

    • Assess cell survival during infection

    • Identify altered resistance or susceptibility phenotypes

  • Phagosome Proteomics:

    • Isolate phagosomes from wild-type and mutant cells

    • Perform comparative proteomics to identify differences in phagosome composition

    • Track recruitment kinetics of key antimicrobial proteins

    • Assess fusion events with lysosomes and other compartments

  • Transcriptional Response Analysis:

    • Perform RNA-seq after bacterial challenge

    • Identify differentially regulated immune-related genes

    • Compare innate immune responses between wild-type and mutant cells

    • Map transcriptional networks involved in defense responses

This multi-faceted approach can determine if DDB_G0291522 contributes to any aspect of host-pathogen interactions, potentially revealing new mechanisms of cellular defense that may be conserved in higher organisms .

What techniques are most appropriate for identifying binding partners of DDB_G0291522?

Identifying interaction partners of transmembrane proteins requires specialized approaches. For DDB_G0291522, the following methods are recommended:

  • Proximity-Based Labeling Techniques:

    • BioID or TurboID fusion constructs expressed in Dictyostelium

    • APEX2-based proximity labeling within membrane compartments

    • Comparative analysis between different cellular conditions

    • Bioinformatic filtering to identify high-confidence interactors

  • Crosslinking Mass Spectrometry (XL-MS):

    • Apply membrane-permeable crosslinkers to intact cells

    • Isolate DDB_G0291522 complexes through affinity purification

    • Perform MS/MS analysis to identify crosslinked peptides

    • Map interaction interfaces using structural modeling

  • Split-Protein Complementation Assays:

    • Implement split-GFP, split-luciferase, or DHFR-based systems

    • Screen candidate interactors based on bioinformatic predictions

    • Visualize interactions in living cells

    • Quantify interaction strength through signal intensity measurements

  • Co-immunoprecipitation with Recombinant Antibodies:

    • Utilize recombinant antibodies generated against DDB_G0291522

    • Perform IP under native conditions that preserve membrane interactions

    • Analyze precipitated complexes by mass spectrometry

    • Validate key interactions through reciprocal co-IP experiments

Table 3. Comparative Analysis of Interaction Detection Methods for DDB_G0291522

MethodAdvantagesLimitationsSuitable for
BioID/TurboIDCaptures transient interactionsRequires viable fusionTopological mapping
XL-MSPreserves native interactionsComplex data analysisDirect binding sites
Split-proteinDirect visualization in cellsMay miss weak interactionsTargeted validation
Co-IP with rAbsIsolates native complexesLimited by antibody qualityComplex composition

These complementary approaches can overcome the challenges inherent in studying transmembrane protein interactions, providing a comprehensive interaction network for DDB_G0291522 .

How can researchers analyze the dynamics of DDB_G0291522 during Dictyostelium development?

Analyzing DDB_G0291522 dynamics throughout Dictyostelium's 24-hour developmental cycle requires temporal and spatial monitoring approaches:

  • Quantitative Expression Analysis:

    • Perform RT-qPCR at defined developmental timepoints (0, 4, 8, 12, 16, 20, 24 hours)

    • Normalize to stable reference genes (e.g., GAPDH)

    • Generate expression profiles across development

  • Live Cell Imaging of Developmental Structures:

    • Generate stable cell lines expressing fluorescently tagged DDB_G0291522

    • Perform time-lapse confocal microscopy during development

    • Track protein localization changes during aggregation, mound formation, and culmination

    • Correlate localization with developmental markers

  • Cell-Type Specific Expression:

    • Isolate pre-stalk and pre-spore cell populations

    • Compare DDB_G0291522 expression levels between cell types

    • Utilize cell-type specific promoters to drive reporter expression

    • Map expression patterns in developing structures

  • Protein Modification Analysis:

    • Monitor post-translational modifications during development

    • Assess protein stability and turnover rates

    • Identify development-specific interacting partners

    • Characterize changes in protein complex composition

This integrated approach provides a comprehensive view of how DDB_G0291522 expression, localization, and function may change during the transition from unicellular to multicellular stages, potentially revealing developmental roles .

How can structural biology approaches be applied to DDB_G0291522 despite its transmembrane nature?

Transmembrane proteins present unique challenges for structural determination. For DDB_G0291522, these specialized approaches are recommended:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Express and purify recombinant DDB_G0291522 in sufficient quantities

    • Reconstitute in nanodiscs or amphipols to stabilize the membrane environment

    • Optimize vitrification conditions to prevent preferred orientation

    • Implement directional refinement and focused classification

    • Expected resolution: 3-4Å for medium-sized transmembrane proteins

  • X-ray Crystallography Adaptations:

    • Screen detergent conditions extensively (>50 conditions recommended)

    • Implement lipidic cubic phase crystallization

    • Consider fusion proteins (e.g., T4 lysozyme) to increase soluble surface area

    • Apply surface entropy reduction through site-directed mutagenesis

    • Validate crystal quality through diffraction screening

  • Nuclear Magnetic Resonance (NMR) Approaches:

    • Focus on specific domains or segments using divide-and-conquer strategies

    • Incorporate isotopic labeling (¹⁵N, ¹³C, ²H) for multidimensional NMR

    • Apply solid-state NMR for full-length protein in native-like membranes

    • Integrate solution and solid-state NMR data for complete structure

  • Integrative Structural Biology:

    • Combine low-resolution techniques (SAXS, negative-stain EM)

    • Implement crosslinking mass spectrometry to define distance constraints

    • Utilize computational modeling constrained by experimental data

    • Validate structural models through mutagenesis of key residues

These approaches overcome the traditional difficulties associated with membrane protein structural studies, providing insights into DDB_G0291522's three-dimensional organization and functional mechanisms .

What approaches can resolve contradictory experimental results regarding DDB_G0291522 function?

When faced with contradictory results in DDB_G0291522 functional studies, implement this systematic resolution framework:

  • Experimental Design Validation:

    • Review control adequacy in contradictory experiments

    • Assess potential confounding variables between studies

    • Examine strain background differences that might affect phenotypes

    • Evaluate sensitivity and specificity of detection methods

  • Independent Validation Approaches:

    • Implement orthogonal experimental techniques to test the same hypothesis

    • Utilize different genetic perturbation strategies (CRISPR, RNAi, dominant negative)

    • Incorporate rescue experiments with wild-type and mutant constructs

    • Collaborate with independent laboratories for blinded replication studies

  • Conditional Dependency Analysis:

    • Test whether contradictory phenotypes are condition-dependent

    • Vary culture conditions, developmental timing, or stress exposures

    • Investigate genetic background effects through complementation

    • Assess whether phenotypes are threshold-dependent or show dose-response relationships

  • Mechanistic Reconciliation:

    • Develop integrative models that can explain seemingly contradictory observations

    • Consider moonlighting functions in different cellular contexts

    • Investigate feedback mechanisms that might produce paradoxical effects

    • Implement mathematical modeling to test whether contradictions can be explained through systems-level properties

This structured approach transforms contradictory results from obstacles into opportunities for deeper mechanistic understanding of DDB_G0291522 function .

How can comparative analysis with other organisms inform DDB_G0291522 research?

Comparative analysis across species can provide valuable insights into DDB_G0291522 function despite its uncharacterized status:

  • Phylogenetic Profiling:

    • Construct comprehensive phylogenetic trees of related proteins

    • Identify orthologs and paralogs across model organisms

    • Map functional annotations from characterized homologs

    • Analyze patterns of conservation/divergence in key domains

  • Cross-Species Complementation:

    • Express potential homologs from other species in DDB_G0291522-null cells

    • Assess functional rescue of phenotypes

    • Perform domain-swapping experiments to identify functional regions

    • Test human homologs if identified to establish translational relevance

  • Comparative Expression Analysis:

    • Compare expression patterns of homologs during development in multiple systems

    • Identify conserved regulatory elements in promoter regions

    • Analyze co-expression networks across species

    • Map onto known developmental or signaling pathways

  • Functional Conservation Testing:

    • Implement CRISPR-Cas9 knockout of homologs in other model systems

    • Compare phenotypic outcomes across species

    • Identify shared binding partners or subcellular localization patterns

    • Establish conserved functional motifs through mutagenesis

This comparative approach contextualizes DDB_G0291522 within evolutionary frameworks, potentially revealing conserved functions that transcend species boundaries and identifying novel aspects unique to Dictyostelium biology .

Citations A. Müller-Taubenberger et al., "Editorial: Dictyostelium: A Tractable Cell and Developmental Model System," Front. Cell Dev. Biol., 2022. "A recombinant antibody toolbox for Dictyostelium discoideum," BMC Res Notes, 2020. "People Also Ask - DataForSEO," 2024. "Design of experiments - Wikipedia," 2025. "The expression characteristics of transmembrane protein genes in normal pancreas and PDAC tissues," Front. Oncol., 2023.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.