Recombinant Dictyostelium discoideum Uncharacterized transmembrane protein DDB_G0293304 (DDB_G0293304)

Shipped with Ice Packs
In Stock

Description

Overview and Production

DDB_G0293304 is a transmembrane protein encoded by the DDB_G0293304 gene in the cellular slime mold Dictyostelium discoideum. The recombinant version is produced in E. coli with an N-terminal His tag for purification . Key specifications include:

PropertyDetails
UniProt IDQ54C03
SourceE. coli expression system
Molecular Weight30.068 kDa
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water, with glycerol (5–50%) for stability

Functional Insights

While functionally uncharacterized, DDB_G0293304 is linked to bacteriolytic activity through:

  • pH-Dependent Lytic Activity: Optimal activity at pH ~2, mimicking acidic phagosomal conditions in D. discoideum .

  • Association with DUF3430 Family: Proteins in this family lyse bacteria with compromised cell walls (e.g., Klebsiella pneumoniae waaQ mutants) .

  • Genetic Evidence: Reduced lytic activity in D. discoideum kil1 knockout mutants, which exhibit impaired bacterial killing .

Experimental Use Cases

  • Bacterial Lysis Assays: Used to study in vitro bacteriolytic activity against gram-negative (E. coli, K. pneumoniae) and gram-positive (S. aureus) bacteria .

  • Protein Interaction Studies: His-tagged purification facilitates pull-down assays to identify binding partners .

  • Structural Analysis: Non-reducing SDS-PAGE reveals disulfide bond-dependent folding .

Key Findings from Proteomic Studies

StudyInsight
Anion Exchange ChromatographyDDB_G0293304 co-purified with lysosomal proteins, suggesting phagosomal role .
Size Exclusion ChromatographyMigrated as a 30–70 kDa complex, indicating oligomerization or cofactor binding .
Antibody DepletionRemoval of BadA-ALFA (a DUF3430 protein) reduced lytic activity by 37% .

Implications and Future Directions

DDB_G0293304 represents a promising candidate for elucidating conserved mechanisms of bacterial degradation in phagocytes. Future work should:

  • Validate its direct role in D. discoideum phagosomal bacteriolysis.

  • Characterize interactions with other lysosomal effectors (e.g., Kil1) .

  • Explore structural determinants of DUF3430 domain function.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
DDB_G0293304; Uncharacterized transmembrane protein DDB_G0293304
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-261
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0293304
Target Protein Sequence
MVETKPKPTEVQKKKTLYEVMFKSREFIIDVYLRFDCFIYLILGGFGFYQPSNLITLLNY SKSDLGLFNNTDSSISNNNNNNNNINTEEQYSTYDNNLLDNQNEFQIDNNNNNNNNEFIP LYQNPILISVVTMYTLMVSLVAIFQCLISLLALIQKEKSTKSILINLSLTLNFFLLLFNT YVLSTQSEIFSKFAYMGLIVSYIISLLDFSALFFLTSKHKSVLSVISSIFSFFLMCLKVR PKLPKLPKLNSNNNNGNKKKK
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic genomic organization of the DDB_G0293304 gene in Dictyostelium discoideum?

The DDB_G0293304 gene encodes an uncharacterized transmembrane protein in Dictyostelium discoideum. As part of the fully sequenced, haploid genome of D. discoideum, this gene can be precisely located and studied with relative ease. The D. discoideum genome is characterized by low redundancy, making it an excellent model system for studying gene function in a true multicellular organism with measurable phenotypic outcomes . To fully characterize the genomic organization, researchers should perform sequence analysis to identify promoter regions, intron-exon boundaries, and regulatory elements that may influence expression patterns during different developmental stages.

What expression patterns does DDB_G0293304 exhibit during Dictyostelium's life cycle?

To determine the expression patterns of DDB_G0293304 during the Dictyostelium life cycle, researchers should utilize RNA sequencing or qRT-PCR across different developmental time points. Dictyostelium has a unique life cycle consisting of a unicellular growth phase followed by a 24-hour multicellular developmental phase with distinct stages . Expression profiling would reveal whether DDB_G0293304 is constitutively expressed or demonstrates stage-specific regulation. This data would provide initial clues about its potential role in either vegetative growth or specific developmental processes such as aggregation, mound formation, slug migration, or fruiting body formation.

How can I determine the subcellular localization of the DDB_G0293304 protein?

To determine subcellular localization, generate a fusion construct expressing DDB_G0293304 with a fluorescent tag (e.g., GFP) under its native promoter or an inducible promoter. Dictyostelium offers various expression constructs that enable studies on protein localization and function . After transforming Dictyostelium cells with this construct, perform confocal microscopy to visualize the localization pattern. Co-localization studies with established organelle markers would further specify its compartmental association. As this is a predicted transmembrane protein, membrane fractionation followed by Western blotting could confirm its association with specific membrane compartments, such as the plasma membrane, endosomal system, or organelle membranes.

What expression systems are optimal for recombinant production of DDB_G0293304?

For recombinant production of DDB_G0293304, consider both heterologous expression systems and homologous expression in Dictyostelium itself. For preliminary studies, bacterial systems (E. coli) may be suitable for expressing soluble domains, while eukaryotic systems (yeast, insect cells) are preferred for full-length transmembrane proteins to ensure proper folding and post-translational modifications . For homologous expression, utilize Dictyostelium's own expression machinery with vectors containing selectable markers such as G418 or blasticidin resistance. For purification, include affinity tags (His-tag , FLAG, or Strep-tag) that can be removed using specific proteases if necessary for downstream functional assays. Optimize expression conditions based on preliminary small-scale tests before scaling up.

What strategies can be employed to generate knockout or knockdown mutants of DDB_G0293304?

Multiple gene disruption strategies are available for Dictyostelium:

  • CRISPR-Cas9 system: Design sgRNAs targeting DDB_G0293304 exons and introduce them alongside Cas9 expression constructs as described by Yamashita et al.

  • Homologous recombination: Create a knockout construct containing a selection marker flanked by segments homologous to the DDB_G0293304 locus.

  • Restriction Enzyme-Mediated Integration (REMI): Use this method for random insertional mutagenesis, followed by screening for insertions in the DDB_G0293304 gene .

  • RNA interference: Design retroelement-based knockdown constructs for targeted reduction of DDB_G0293304 expression .

The advantage of Dictyostelium's haploid genome is that a single gene disruption event can create a complete null phenotype, facilitating functional studies in a true multicellular context .

How can I validate antibodies for detecting endogenous DDB_G0293304?

For antibody validation:

  • Generate specific antibodies against predicted antigenic regions of DDB_G0293304.

  • Perform Western blot analysis comparing wild-type and knockout/knockdown strains to confirm specificity and absence of cross-reactivity.

  • Include positive controls using cells expressing tagged versions of DDB_G0293304.

  • Validate antibody specificity through immunoprecipitation followed by mass spectrometry.

  • For immunofluorescence applications, compare staining patterns between wild-type cells, knockout cells, and cells expressing fluorescently tagged DDB_G0293304 to confirm specificity.

Always include appropriate controls in all experiments, and consider epitope masking that might occur in certain cellular compartments or under specific conditions.

What approaches can be used to identify potential binding partners of DDB_G0293304?

To identify binding partners of DDB_G0293304, implement these complementary approaches:

  • Affinity purification coupled with mass spectrometry (AP-MS): Express tagged DDB_G0293304 in Dictyostelium, perform immunoprecipitation under native conditions, and identify co-purifying proteins using mass spectrometry.

  • Proximity-based labeling: Fuse DDB_G0293304 with BioID or APEX2 to biotinylate proximal proteins, followed by streptavidin purification and mass spectrometry.

  • Yeast two-hybrid screening: Use different domains of DDB_G0293304 as baits to screen Dictyostelium cDNA libraries.

  • Co-immunoprecipitation validation: Confirm primary interactions using reciprocal co-immunoprecipitation experiments.

  • Bioinformatic analysis: Predict potential interactors based on homology to known protein interaction networks in other organisms.

Perform these experiments under different conditions (vegetative growth, developmental stages, stress conditions) to capture context-dependent interactions.

How do I determine if DDB_G0293304 is involved in chemotaxis or cell motility?

Given Dictyostelium's established role as a model for studying cell motility and chemotaxis , implement these approaches:

  • Under-agarose chemotaxis assay: Compare wild-type and DDB_G0293304 knockout cells migrating toward chemoattractants like cAMP or folate.

  • Micropipette chemotaxis assay: Analyze cellular responses to a point source of chemoattractant using time-lapse microscopy.

  • Quantitative motility analysis: Track random cell movement parameters (speed, persistence, turning frequency) in the absence of chemoattractants.

  • Actin cytoskeleton visualization: Examine F-actin dynamics using LifeAct or phalloidin staining during migration.

  • PIP3 dynamics: Monitor PIP3 production during chemotaxis using PH-domain reporters, as PIP3 is crucial for directional sensing .

ParameterWild-typeDDB_G0293304 KnockoutStatistical Significance
Speed (μm/min)X ± SDY ± SDp-value
DirectionalityX ± SDY ± SDp-value
PersistenceX ± SDY ± SDp-value
cAMP sensitivity thresholdX nMY nMp-value

This experimental approach directly connects to established Dictyostelium research methodologies for studying chemotaxis and cell motility signaling pathways .

What role might DDB_G0293304 play in Dictyostelium development and differentiation?

To investigate the role of DDB_G0293304 in development:

  • Developmental time course: Induce starvation in DDB_G0293304 knockout and wild-type cells, documenting developmental progression at 2-hour intervals over 24 hours.

  • Cell-type specific markers: Use established markers (prespore, prestalk) to assess if DDB_G0293304 affects cell fate determination.

  • Developmental gene expression: Perform RNA-seq or qRT-PCR at key developmental timepoints to identify dysregulated genes.

  • Chimeric development: Mix GFP-labeled knockout cells with unlabeled wild-type cells to assess cell-autonomous versus non-cell-autonomous effects.

  • Developmental rescue experiments: Reintroduce DDB_G0293304 under control of stage-specific promoters to pinpoint critical developmental windows.

Dictyostelium development serves as an excellent model for studying cell differentiation and morphogenesis, with many conserved signaling pathways relevant to metazoan development but occurring in a much shorter timeframe .

How can I determine if DDB_G0293304 has human orthologs with potential disease relevance?

To identify human orthologs with disease relevance:

The Dictyostelium genome encodes orthologs of genes associated with human disease, and signaling pathways are remarkably similar to those in mammalian cells, allowing findings from Dictyostelium to be successfully translated to mammalian systems .

Can DDB_G0293304 be used to study membrane protein trafficking in a disease context?

Dictyostelium provides an excellent system for studying membrane protein trafficking with disease relevance:

  • Trafficking assays: Track the movement of fluorescently-tagged DDB_G0293304 through the secretory and endocytic pathways under normal and stress conditions.

  • Lysosomal targeting: Determine if DDB_G0293304 traffics to lysosomes and whether this process is affected by mutations in lysosomal trafficking machinery.

  • Disease-relevant mutations: Introduce mutations corresponding to those found in human disease-associated membrane proteins to see if they affect trafficking.

  • Drug screening: Use Dictyostelium's insertional mutant libraries to conduct pharmacogenetic screens that could identify compounds affecting membrane protein trafficking .

  • Autophagy connection: Determine if DDB_G0293304 plays a role in autophagy, a process extensively studied in Dictyostelium that is relevant to many human diseases .

This approach is supported by previous research where Dictyostelium models have provided insights into lysosomal storage diseases like mucolipidosis type IV and Batten disease .

How can post-translational modifications of DDB_G0293304 be characterized in relation to protein function?

To characterize post-translational modifications (PTMs):

  • Mass spectrometry analysis: Purify DDB_G0293304 under native conditions and perform LC-MS/MS to identify PTMs such as phosphorylation, glycosylation, and ubiquitination.

  • Site-directed mutagenesis: Mutate identified PTM sites to assess their functional significance.

  • Conditional PTM analysis: Compare PTM profiles under different conditions (growth, development, stress).

  • PTM-specific antibodies: Develop antibodies against specific modified forms of DDB_G0293304.

  • Inhibitor studies: Use PTM pathway inhibitors to determine which modifications are essential for protein function.

Create a comprehensive PTM map using this approach:

ResidueModification TypeCondition PresentFunctional Impact
SerXPhosphorylationStarvationAffects localization
LysYUbiquitinationGrowth phaseRegulates stability
AsnZN-glycosylationConstitutiveRequired for folding

How can CRISPR-Cas9 genome editing be optimized for studying DDB_G0293304?

To optimize CRISPR-Cas9 genome editing for DDB_G0293304:

  • sgRNA design: Design multiple sgRNAs targeting different exons of DDB_G0293304, avoiding regions with potential off-target effects.

  • Homology-directed repair templates: Create donor templates with selection markers and fluorescent tags for precise gene modification.

  • Conditional systems: Implement conditional knockouts using inducible Cas9 or sgRNA expression systems to study essential functions.

  • Base editing applications: Use base editors for introducing specific point mutations without requiring double-strand breaks.

  • Multiplexed editing: Target DDB_G0293304 alongside interacting partners to study genetic interactions.

Dictyostelium researchers have successfully implemented CRISPR-based gene disruption methods, though optimization for specific genes is still required . Begin with pilot experiments testing different delivery methods and sgRNA combinations to determine the most efficient approach for DDB_G0293304.

What high-throughput screening approaches can identify compounds that modulate DDB_G0293304 function?

For high-throughput screening:

  • Phenotypic screening: Screen compound libraries using DDB_G0293304 knockout strains, looking for rescue or enhancement of phenotypes.

  • Fluorescence-based assays: Develop assays using fluorescently tagged DDB_G0293304 to monitor changes in localization or stability in response to compounds.

  • Insertional mutant libraries: Utilize existing Dictyostelium insertional mutant libraries to conduct pharmacogenetic screens, which have enhanced understanding of bioactive compounds at a cellular level .

  • Positive selection genetic screens: Implement approaches similar to those developed by Williams et al. to select for genetic modifiers of DDB_G0293304 function.

  • Biosensor development: Design biosensors that report on DDB_G0293304 activity or its downstream signaling pathways.

This strategy leverages Dictyostelium's advantages as an inexpensive and high-throughput model system for studying cellular processes and identifying bioactive compounds .

How can systems biology approaches integrate DDB_G0293304 into broader cellular networks?

To integrate DDB_G0293304 into cellular networks:

  • Transcriptomics: Perform RNA-seq comparing wild-type and DDB_G0293304 knockout cells under multiple conditions to identify affected pathways.

  • Proteomics: Use SILAC or TMT labeling to quantify proteome-wide changes in DDB_G0293304 mutants.

  • Phosphoproteomics: Identify signaling pathways affected by DDB_G0293304 deletion through phosphoproteomic analysis.

  • Metabolomics: Perform targeted or untargeted metabolomics to identify metabolic pathways influenced by DDB_G0293304.

  • Network analysis: Integrate multi-omics data to construct comprehensive interaction networks and identify key nodes connecting DDB_G0293304 to cellular processes.

  • Mathematical modeling: Develop predictive models of pathways involving DDB_G0293304, particularly if it's involved in chemotaxis or development.

This systems approach allows researchers to position an uncharacterized protein within the broader cellular context, leveraging Dictyostelium's advantages as a simpler eukaryotic system while maintaining many genes and related signaling pathways found in more complex eukaryotes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.