Recombinant Dictyostelium discoideum UPF0041 protein B (DDB_G0268478)

Shipped with Ice Packs
In Stock

Description

Understanding UPF0041 Proteins

UPF0041 proteins belong to a family of uncharacterized proteins found in various organisms. These proteins are often involved in cellular processes, but their exact functions can vary widely depending on the organism and context. In Dictyostelium discoideum, proteins like UPF0041 might play roles in cellular differentiation, signaling, or other biological processes, given the organism's complex life cycle, which includes both unicellular and multicellular stages.

Research on Dictyostelium discoideum

Dictyostelium discoideum is a valuable model organism for studying cell biology, including processes such as chemotaxis, cell differentiation, and protein function. Its proteome is rich in proteins with unique properties, such as prion-like proteins, which are unusually resilient to aggregation . This resilience suggests that D. discoideum has evolved specific mechanisms to manage protein stability and function.

Potential Applications and Research Directions

While specific research on UPF0041 protein B is scarce, the study of proteins in Dictyostelium discoideum can lead to insights into cellular processes and potential therapeutic applications. For instance, compounds derived from D. discoideum, such as differentiation-inducing factors (DIFs), have shown promise in drug discovery for diseases like cancer and diabetes .

Data and Research Findings

Given the lack of specific data on UPF0041 protein B, we can look at broader research findings related to Dictyostelium discoideum proteins:

Protein/CompoundFunction/RoleRelevance
DIF-1, DIF-2, DIF-3Induce stalk-cell differentiation, modulate chemotaxisDrug discovery for diseases like cancer and diabetes
Prion-like proteinsResilient to aggregation, involved in cellular proteostasisInsights into neurodegenerative diseases
Bacteriolytic proteinsInvolved in bacterial defense mechanismsPotential applications in antimicrobial research

References

- Role of Salmonella enterica serovar Typhimurium effectors proteins.
- Dictyostelium: An Important Source of Structural and Functional Diversity in Drug Discovery.
- Dictyostelium discoideum has a highly Q/N-rich proteome and shows an unusual resilience to protein aggregation.
- A New Family of Bacteriolytic Proteins in Dictyostelium discoideum.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may be adjusted as required.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DDB_G0268478; Probable mitochondrial pyruvate carrier 2; MPC2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0268478
Target Protein Sequence
MNALRGLLNKYTGNQIVFSNKYATTFFEKFPKLAFLNNVTNLAPMMKWSLSIVPITQILS GTKLPENIDVYQASSLCATGSIWTYYATLISPQNTGTRMLAACNAAMAACHGYNIYRRTK WEKSQIIPIENKN
Uniprot No.

Target Background

Function
May mediate the uptake of pyruvate into mitochondria.
Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is UPF0041 protein B and why is it significant in D. discoideum research?

UPF0041 protein B belongs to a family of proteins in D. discoideum that may have bacteriolytic properties. While not explicitly characterized in the literature, it likely shares structural features with other bacteriolytic proteins found in D. discoideum, such as the recently identified Bad protein family that contains a DUF3430 domain of unknown function . The significance of studying UPF0041 protein B lies in its potential role in D. discoideum's innate immune response against bacteria and its possible contribution to phagosomal bacterial killing. As a model organism, insights gained from studying this protein could enhance our understanding of similar proteins in other phagocytic cells, including those in higher organisms.

What methods can be used to predict the domain structure of UPF0041 protein B?

The domain structure of UPF0041 protein B can be predicted through multiple bioinformatic approaches. Begin with sequence analysis using tools like SMART, Pfam, or InterPro to identify conserved domains. Similar proteins in D. discoideum, such as the Bad family proteins, typically contain an N-terminal signal sequence for translocation into the endoplasmic reticulum, followed by functional domains that contribute to their bacteriolytic activity . Prediction of secondary structure elements can be performed using PSIPRED or JPred. For tertiary structure prediction, AlphaFold2 or I-TASSER can generate structural models based on homology. These predictions should be validated experimentally through limited proteolysis, which can define domain boundaries, followed by recombinant expression of individual domains to confirm their functional independence.

How conserved is UPF0041 protein B across different Dictyostelid species?

To assess the conservation of UPF0041 protein B across Dictyostelid species, comparative genomic analysis should be performed using the available genome sequences from various Dictyostelium species including D. discoideum, D. purpureum, D. caveatum, and others . Multiple sequence alignment tools such as Clustal Omega or MUSCLE can identify conserved regions that may be functionally important. Phylogenetic analysis using maximum likelihood or Bayesian methods can then establish evolutionary relationships between orthologs. Highly conserved regions often correspond to functional domains essential for protein activity. The degree of conservation can provide insights into functional constraints and potentially inform experimental design for site-directed mutagenesis studies.

What expression systems are most effective for producing recombinant UPF0041 protein B?

For optimal expression of recombinant UPF0041 protein B, several systems can be considered based on the intended experimental use:

The choice depends on protein characteristics and intended use. For structural studies requiring large amounts of protein, E. coli may be preferred, while functional studies might benefit from the homologous D. discoideum system.

What purification strategy yields the highest purity of UPF0041 protein B?

A multi-step purification strategy is recommended for UPF0041 protein B, similar to approaches used for other D. discoideum proteins:

  • Initial capture: If the protein has been tagged, use affinity chromatography (e.g., Ni-NTA for His-tagged proteins or anti-FLAG for FLAG-tagged proteins).

  • Intermediate purification: Ion exchange chromatography can be employed, similar to the anion exchange step used for purifying Bad proteins, which eluted in the 150-300 mM NaCl fraction .

  • Polishing step: Size exclusion chromatography to separate the target protein based on molecular size. The Bad proteins exhibited an apparent size between 30-70 kDa on a Sephadex column .

  • Quality control: Assess purity by SDS-PAGE and Western blotting. Confirm identity by mass spectrometry.

For proteins with bacteriolytic activity, ensure all buffers maintain the protein's native conformation and activity. Consider including protease inhibitors throughout the purification process to prevent degradation.

How can the stability and activity of purified UPF0041 protein B be optimized?

Optimizing the stability and activity of purified UPF0041 protein B requires careful buffer selection and storage conditions:

  • Buffer optimization: Conduct a buffer screen testing different pH values (4.0-9.0), salt concentrations (0-500 mM NaCl), and additives (glycerol, reducing agents). If UPF0041 protein B shares properties with the Bad family, it may exhibit optimal activity under acidic conditions (pH ~2.0) that mimic the D. discoideum phagosomal environment .

  • Stability assessment: Use differential scanning fluorimetry (DSF) to determine thermal stability across different buffer conditions. Monitor protein activity over time using functional assays.

  • Storage conditions: Test protein stability at different temperatures (4°C, -20°C, -80°C) and with cryoprotectants (10-20% glycerol, trehalose). Flash-freezing in liquid nitrogen with cryoprotectants often preserves activity better than slow freezing.

  • Prevent aggregation: Consider adding low concentrations of non-ionic detergents (0.01-0.05% Tween-20) if hydrophobic regions cause aggregation.

  • Activity preservation: For bacteriolytic proteins in D. discoideum, activity is often pH-dependent. Ensure storage and assay buffers maintain the optimal pH for activity .

What experimental approaches can determine if UPF0041 protein B has bacteriolytic activity?

To determine if UPF0041 protein B possesses bacteriolytic activity similar to the Bad family proteins, a systematic approach combining in vitro and cellular assays should be employed:

  • In vitro bacteriolytic assay: Incubate purified recombinant UPF0041 protein B with bacteria (such as Klebsiella pneumoniae) at varying pH values, particularly testing acidic conditions (pH ~2) that mimic the phagosomal environment . Monitor bacterial lysis spectrophotometrically by measuring the decrease in optical density at 600 nm over time.

  • Fluorescence-based lysis assay: Use bacteria expressing fluorescent proteins or loaded with fluorescent dyes. Release of fluorescence upon bacterial lysis provides a quantitative measure of bacteriolytic activity.

  • Agar plate-based assay: Create zones of inhibition assays by spotting the purified protein onto bacterial lawns and measuring the resulting clearing zones.

  • Cellular co-incubation studies: Develop D. discoideum strains overexpressing UPF0041 protein B and assess their ability to kill bacteria compared to wild-type amoebae . This approach can confirm the protein's role in bacterial killing within living cells.

  • Electron microscopy: Visualize the direct effect of the protein on bacterial cell wall or membrane integrity using transmission electron microscopy.

What genetic manipulation techniques are most effective for studying UPF0041 protein B function in D. discoideum?

D. discoideum offers multiple genetic manipulation options for studying UPF0041 protein B function:

  • Gene knockout via homologous recombination: This highly efficient technique (up to 90% success rate) can completely eliminate gene expression . The Cre-loxP system allows marker recycling for creating multiple gene knockouts in the same strain, which is valuable for studying gene families.

  • RNA interference (RNAi): For essential genes where knockout might be lethal, RNAi constructs can reduce gene expression levels without completely eliminating the protein.

  • Overexpression systems: The actin15 or discoidin promoters can drive constitutive expression, while the inducible discoidin promoter allows controlled expression timing.

  • Fluorescent protein tagging: C- or N-terminal tagging with GFP or RFP enables visualization of protein localization and dynamics in living cells.

  • REMI (Restriction Enzyme-Mediated Integration): This random insertion mutagenesis technique can be used for forward genetic screens to identify genes interacting with UPF0041 protein B .

  • CRISPR-Cas9 editing: This newer technique enables precise genome editing with minimal off-target effects.

The choice of technique should be guided by the specific research question, with knockout approaches being most suitable for determining essential functions.

How can high-throughput approaches identify interaction partners of UPF0041 protein B?

To identify interaction partners of UPF0041 protein B in a comprehensive manner, several complementary high-throughput approaches should be considered:

  • Affinity purification-mass spectrometry (AP-MS): Express UPF0041 protein B with an affinity tag (FLAG, HA, or His) in D. discoideum, immunoprecipitate the protein complex, and analyze co-purifying proteins by LC-MS/MS. This approach successfully identified 37 proteins during the purification of bacteriolytic activity from D. discoideum .

  • Proximity-dependent biotin identification (BioID): Fuse UPF0041 protein B with a biotin ligase (BirA*) to biotinylate nearby proteins, which can then be purified and identified by mass spectrometry.

  • Yeast two-hybrid screening: Use UPF0041 protein B as bait to screen a D. discoideum cDNA library for interacting proteins.

  • Co-fractionation analysis: Monitor the co-elution patterns of UPF0041 protein B with other proteins across multiple chromatographic separations to identify potential protein complexes.

  • Crosslinking mass spectrometry (XL-MS): Use chemical crosslinkers to stabilize transient interactions before mass spectrometric analysis.

  • Functional proteomic screens: Compare the proteome of wild-type and UPF0041 protein B knockout D. discoideum cells using SILAC or TMT labeling to identify differentially expressed proteins.

Data from these approaches should be integrated and validated using targeted techniques such as co-immunoprecipitation and fluorescence co-localization studies.

How does UPF0041 protein B potentially contribute to D. discoideum's immune defense mechanisms?

UPF0041 protein B likely plays a role in D. discoideum's sophisticated defense against bacteria through multiple potential mechanisms:

  • Phagosomal bacterial killing: If UPF0041 protein B shares functional properties with the Bad family proteins, it may contribute to bacterial lysis within the highly acidic phagosomal compartment (pH ~2) . This activity would complement other known antimicrobial factors in D. discoideum, such as those dependent on the Kil1 and Kil2 proteins.

  • Pattern recognition: The protein might function in recognizing bacterial cell wall components, similar to how D. discoideum differentially responds to various bacterial species like K. pneumoniae, particularly distinguishing between wild-type and waaQ mutant strains .

  • Signaling pathway integration: UPF0041 protein B could participate in signaling cascades that regulate the phagocytic response, potentially interacting with proteins involved in phagosome maturation or autophagy pathways, similar to the functions of Atg proteins in D. discoideum .

  • Secreted antimicrobial agent: The protein might be secreted into the extracellular environment as part of a collaborative defense mechanism, particularly during the multicellular stage of D. discoideum development.

Comparative studies with kil1 KO mutants, which show reduced bacteriolytic activity and impaired bacterial killing , could provide insights into how UPF0041 protein B functions within the broader antimicrobial defense system of D. discoideum.

How can UPF0041 protein B research contribute to understanding human innate immunity?

Research on UPF0041 protein B in D. discoideum can provide valuable insights into human innate immunity through several parallel mechanisms:

  • Conserved phagocytic pathways: D. discoideum and human phagocytes share many conserved molecular mechanisms for bacterial engulfment and killing. Understanding UPF0041 protein B's role in this process could reveal principles applicable to human neutrophils and macrophages .

  • Novel antimicrobial mechanisms: The unique bacteriolytic activity observed in D. discoideum proteins, including potentially UPF0041 protein B, may represent evolutionarily conserved antimicrobial strategies that could inspire new approaches to combat antibiotic-resistant bacteria in humans.

  • Phagosome biology: D. discoideum's phagosomal acidification and maturation processes mirror those in human cells. Insights into how UPF0041 protein B functions in the acidic phagosomal environment (pH ~2) could inform our understanding of similar processes in human phagocytes.

  • Microbial evasion strategies: By studying how different bacterial strains respond to UPF0041 protein B, researchers can better understand bacterial adaptations that enable pathogen survival within phagocytes—a critical factor in many human infectious diseases.

  • Drug target identification: As demonstrated with the anticancer agent cisplatin and the psychiatric drug lithium, D. discoideum has proven valuable for identifying drug targets relevant to human diseases . UPF0041 protein B research could similarly reveal targetable pathways for immunomodulatory therapeutics.

What contraindications exist when extrapolating UPF0041 protein B findings from D. discoideum to other organisms?

When extrapolating findings about UPF0041 protein B from D. discoideum to other organisms, particularly humans, several important contraindications and limitations must be considered:

These contraindications necessitate validation of findings in higher organisms, ideally through identification and characterization of functionally similar proteins in mammalian systems.

What are the optimal conditions for bacteriolytic activity assays with recombinant UPF0041 protein B?

Based on studies of similar bacteriolytic proteins in D. discoideum, the following conditions should be optimized for UPF0041 protein B activity assays:

  • pH optimization: Test a range of pH conditions with particular focus on acidic pH (1.5-3.0) that mimics the D. discoideum phagosomal environment, where bacteriolytic activity of similar proteins was observed to be highest . Use appropriate buffer systems for each pH range (e.g., glycine-HCl for pH 1.5-3.0, acetate for pH 3.5-5.5).

  • Bacterial strain selection: Include both wild-type and susceptible mutant strains. For example, K. pneumoniae waaQ mutants showed increased susceptibility to D. discoideum bacteriolytic proteins compared to wild-type K. pneumoniae . A panel of diverse bacterial species would provide comprehensive activity profiling.

  • Temperature conditions: While D. discoideum optimally grows at 22°C , test activity across a temperature range (4-37°C) to determine the optimal temperature for the isolated protein's activity.

  • Time course analysis: Monitor bacteriolytic activity at multiple time points (0-24 hours) to establish kinetics of bacterial killing.

  • Protein concentration titration: Test a range of protein concentrations (1-100 μg/ml) to establish dose-response relationships and determine the minimal effective concentration.

  • Cofactor requirements: Systematically test the effect of divalent cations (Ca²⁺, Mg²⁺, Zn²⁺), reducing agents, and other potential cofactors on bacteriolytic activity.

  • Activity quantification: Use complementary methods including optical density measurements (OD600), viable count determination (CFU/ml), and fluorescence-based viability assays to robustly quantify bacteriolytic activity.

How can researchers investigate the physiological relevance of UPF0041 protein B in D. discoideum?

To investigate the physiological relevance of UPF0041 protein B in D. discoideum, a multifaceted approach combining genetic, cellular, and biochemical methods is recommended:

  • Gene expression analysis: Examine the expression profile of UPF0041 protein B across different developmental stages and in response to various bacterial challenges using RNA-seq or qRT-PCR. This will reveal when and under what conditions the protein is most abundant.

  • Genetic manipulation studies: Generate knockout, knockdown, and overexpression strains using homologous recombination or CRISPR-Cas9 techniques . Compare these strains' ability to phagocytose and kill various bacterial species. The efficiency of homologous recombination in D. discoideum (up to 90%) makes this approach particularly feasible .

  • Co-localization experiments: Use fluorescently tagged UPF0041 protein B to visualize its subcellular localization during phagocytosis and bacterial killing, with particular attention to whether it localizes to phagosomes.

  • Bacterial challenge assays: Compare the survival of wild-type and UPF0041 protein B mutant D. discoideum when exposed to different bacterial species at various MOIs (multiplicities of infection), similar to assays used with C. albicans .

  • Proteomic analysis of phagosomes: Isolate phagosomes at different maturation stages and perform proteomic analysis to determine if and when UPF0041 protein B is recruited to these compartments.

  • Comparative studies with known mutants: Compare phenotypes with those of established mutants affecting phagocytosis or bacterial killing, such as kil1 and kil2 knockout strains .

  • Bacterial transcriptional response: Analyze the transcriptional changes in bacteria exposed to purified UPF0041 protein B to understand how bacteria respond to this potential stress factor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.