Recombinant Dictyostelium discoideum UPF0420 protein (DDB_G0277179)

Shipped with Ice Packs
In Stock

Description

Introduction

Dictyostelium discoideum is a cellular slime mold that is utilized as a model organism to study various biological processes, including cell and developmental biology . The Dictyostelium discoideum genome encodes a large number of proteins with diverse functions, including the UPF0420 protein (DDB_G0277179). Recombinant Dictyostelium discoideum UPF0420 protein (DDB_G0277179) refers to the protein produced using recombinant DNA technology, allowing for detailed studies of its structure, function, and interactions.

General Information of Dictyostelium discoideum

Dictyostelium discoideum exhibits a simple life cycle and is easy to use in laboratory settings, making it an excellent model for research . Dictyostelium can serve as a source of novel lead compounds for pharmacological and medical research . This organism is valuable in studying programmed cell death, autophagy, and chemotaxis .

Characteristics of UPF0420 Protein

The UPF0420 protein (DDB_G0277179) is a conserved protein of unknown function, and it belongs to the UPF0420 family. Proteins in this family are found in various organisms, suggesting a conserved biological role. Dictyostelium discoideum has a high content of prion-like proteins, and it shows unusual resilience to protein aggregation . Overexpressed prion-like proteins remain soluble and are innocuous to D. discoideum, indicating specific adaptations in its proteostasis machinery .

Recombinant Production

Recombinant production of the DDB_G0277179 protein involves cloning the gene encoding the protein into an expression vector, introducing the vector into a host cell (e.g., E. coli, yeast, or mammalian cells), and inducing protein expression. The recombinant protein is then purified for downstream applications such as structural studies, functional assays, and interaction studies.

Potential Functions and Roles

While the specific function of UPF0420 protein (DDB_G0277179) is not well-defined, several possibilities can be inferred based on its presence in Dictyostelium discoideum and other organisms:

  • Involvement in Development: Given that Dictyostelium discoideum is a model for studying development, UPF0420 might play a role in cell differentiation or morphogenesis .

  • Regulation of Proteostasis: Dictyostelium discoideum's ability to handle aggregation-prone proteins suggests UPF0420 could be involved in proteostasis or protein quality control .

  • Interaction with Ribosomes: Some ribosomal proteins in Dictyostelium discoideum are developmentally regulated, suggesting that UPF0420 could interact with ribosomes or affect protein synthesis .

  • Response to Stress: UPF0420 might be involved in the organism's response to stress, as Dictyostelium discoideum has specific adaptations to tolerate stress-induced protein aggregation .

Research and Experimental Findings

CategoryFindingReference
ProteostasisD. discoideum has a high content of prion-like proteins and shows resilience to protein aggregation.
Ribosomal ProteinsRibosomal protein genes in D. discoideum are developmentally regulated.
Differentiation FactorsDifferentiation-inducing factors (DIFs) in D. discoideum modulate chemotactic cell movement and induce stalk-cell differentiation.
Novel Lead CompoundsD. discoideum is a potential source of novel lead compounds for pharmacological research.
Protein SupplementationProtein consumption after a workout provides greater benefits in increasing protein synthesis and muscle hypertrophy .

Future Directions

Further research is needed to elucidate the specific function of UPF0420 protein (DDB_G0277179). Key areas of investigation could include:

  • Structural Studies: Determining the 3D structure of the protein to understand its potential interactions.

  • Interaction Studies: Identifying the binding partners of UPF0420 to understand its role in cellular processes.

  • Phenotypic Analysis: Investigating the effects of knocking out or overexpressing UPF0420 in Dictyostelium discoideum to observe any changes in development, proteostasis, or stress response.

  • Expression Analysis: Examining the expression pattern of UPF0420 during different stages of the Dictyostelium discoideum life cycle to understand its temporal role.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rusf1; DDB_G0277179; RUS family member 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-527
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
DDB_G0277179
Target Protein Sequence
MQYNGKSQQSINKINCIIEKNQSNSIINKFQVASPYDDYDDRLNFLETIEKNSGFYNVLC ELFLPNGYPDSVTTDYFGYQFWDSIQALCSTITGTLATRAILKGYGVGDSSATVASATTQ WLIRDGMGMIGRIVFAWRKGTDLDCNSKKWRYTADILNNIGMAFEMISPLFSSQLFLPLS CIGLIAKSICGVAGGCTKASLTQHFAKRDNLADVSAKDGSQETAVNLVGMLLSVIVSSFI NDNTSLIVTWLVFLFFTSLHLFCNYRAVSAVQLKSINRYRAYLIYDYFIHNQGSIPSPSE ISKLENILFSIKELDIRVGVSLCNIYKVQQKQQKLNNQFLQQKLNNITKTKNVNNNNNNN NNNNNNNNNNNNNKNNNINNINNNINNNINNNINNNINNKNNNNNNNNNNNNNNNNNNNN NNNNNKNSLEIIKKIKKSKSFIIWKKHSQRGNKILEKDFTLLIALLNGSTTRDMIESYFY AVEYFHLSSVQIPPTINISGTFFKRLEEKGWDLDRALLNSEGWTFGI
Uniprot No.

Target Background

Database Links
Protein Families
RUS1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is UPF0420 protein (DDB_G0277179) and what organism does it originate from?

UPF0420 protein (DDB_G0277179), also known as rusf1 or RUS family member 1, is a protein found in Dictyostelium discoideum (slime mold). It belongs to a family of proteins characterized by domains of unknown function. Dictyostelium discoideum has been established as an important model organism for biomedical research, particularly for studying cellular processes such as phagocytosis, chemotaxis, and cell motility .

What expression systems are available for producing recombinant DDB_G0277179 protein?

Recombinant DDB_G0277179 protein can be produced in multiple expression systems, each with distinct advantages for different research applications:

Expression SystemCatalog ID ExampleAdvantagesBest Applications
YeastCSB-YP803091DKK1Post-translational modifications, proper foldingStructural studies requiring eukaryotic modifications
E. coliCSB-EP803091DKK1High yield, cost-effectiveFunctional assays, antibody production
E. coli (Biotinylated)CSB-EP803091DKK1-BIn vivo biotinylation via AviTag-BirA technologyProtein interaction studies, pull-down assays
BaculovirusCSB-BP803091DKK1Complex eukaryotic modificationsEnzymatic activity studies
Mammalian cellCSB-MP803091DKK1Native-like folding and modificationsFunctional studies requiring mammalian PTMs

The selection of an appropriate expression system should be determined by your specific experimental requirements .

How does Dictyostelium discoideum serve as a model organism for research?

Dictyostelium discoideum has been chosen by the NIH as a non-mammalian model organism for biomedical research due to its unique biological properties. This organism is particularly valuable for studying:

  • Cell motility and chemotaxis mechanisms

  • Phagocytosis and endocytic vesicle trafficking

  • Host-pathogen interactions

  • Pattern formation and development

  • Caspase-independent cell death

  • Autophagy processes

  • Social evolution

The D. discoideum genome contains numerous homologs of human genes associated with various diseases, including Chediak-Higashi syndrome, lissencephaly, mucolipidosis, and Huntington disease, making it an excellent model for investigating these conditions .

What is known about the function of the UPF0420 domain in Dictyostelium proteins?

While the specific function of UPF0420 in DDB_G0277179 is not fully characterized, related protein families in Dictyostelium with domains of unknown function (such as the DUF3430 domain found in the Bad protein family) have been implicated in bacteriolytic activity. These proteins function optimally at very acidic pH (approximately pH 2), similar to conditions found in D. discoideum endosomes and phagosomes.

The bacteriolytic activity of these proteins appears to be linked to the destruction of ingested bacteria in phagosomes. For example, the BadA protein, when overexpressed in cells, increases bacteriolytic activity in cell extracts and accelerates bacterial killing compared to parental cells. Conversely, depletion of BadA significantly decreases bacteriolytic activity .

This suggests that proteins with uncharacterized domains in Dictyostelium may play crucial roles in cellular defense against bacteria, and further investigation of UPF0420 might reveal similar antimicrobial functions.

How can I design efficient gene disruption experiments for DDB_G0277179 in Dictyostelium?

For efficient gene disruption of DDB_G0277179 in Dictyostelium, a Cre-mediated recombination system offers significant advantages, especially when creating multiple gene disruptions:

Recommended Protocol:

  • Create a disrupting gene construct with the Bsr (blasticidin resistance) marker flanked by loxP sites.

  • Transform the construct into Dictyostelium cells.

  • Select transformed cells using blasticidin.

  • Isolate individual colonies and verify genomic integration by PCR using primers outside the floxed-Bsr insertion.

  • Confirm disruption by Southern blot hybridization to ensure there are no secondary insertion sites.

  • To create multiple gene disruptions, induce Cre-mediated recombination to remove the Bsr marker.

  • Verify Bsr removal and proceed with subsequent gene disruptions.

This approach has demonstrated approximately 80% targeting efficiency and allows for recycling of the selectable marker, enabling the creation of multiple mutations within a single cell line .

What are the optimal conditions for reconstitution and storage of recombinant DDB_G0277179?

For optimal reconstitution and storage of lyophilized recombinant DDB_G0277179:

  • Briefly centrifuge the vial before opening to ensure all content settles at the bottom.

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% to enhance protein stability.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

  • Store aliquots at -20°C for short-term or -80°C for long-term storage.

Protein stability can be monitored using size exclusion chromatography (SEC) to verify that the protein remains monomeric and properly folded. Recent studies have shown that properly reconstituted recombinant proteins maintain stability for experimental applications .

How can I optimize expression and purification of DDB_G0277179 for structural studies?

For structural studies of DDB_G0277179, consider these optimization strategies:

Expression System Selection:

  • For NMR studies: E. coli expression with isotope labeling (15N, 13C)

  • For X-ray crystallography: Insect cell or mammalian expression systems that may enhance proper folding

Purification Strategy:

  • Utilize a combination of affinity chromatography (via protein tag) and size exclusion chromatography

  • Include protease inhibitors throughout the purification process

  • Maintain stable buffer conditions (pH, salt concentration) based on protein stability analysis

  • For difficult-to-crystallize proteins, consider surface entropy reduction mutations

Tag Selection Considerations:

Tag TypeAdvantagesLimitationsRecommended Use Cases
His-tagSmall size, minimal interferenceMay affect metal-binding studiesInitial purification
GST-tagEnhances solubilityLarge size may interfere with structureImproving solubility of difficult proteins
Avi-tagSite-specific biotinylationRequires BirA ligase co-expressionSurface immobilization studies
MBP-tagSignificantly improves solubilityVery large tag requires removalHighly insoluble proteins

Recently developed approaches like RFdiffusion can be employed for structure prediction and validation, as these methods have shown success with protein structure determination .

What methodologies are recommended for studying protein-protein interactions involving DDB_G0277179?

For investigating protein-protein interactions of DDB_G0277179:

In vitro methods:

  • Pull-down assays: Utilizing the biotinylated version (CSB-EP803091DKK1-B) with streptavidin beads provides a clean system for identifying binding partners.

  • Surface Plasmon Resonance (SPR): For quantitative binding kinetics measurements.

  • Isothermal Titration Calorimetry (ITC): For thermodynamic characterization of interactions.

In vivo methods:

  • Proximity-dependent biotin identification (BioID): Fuse BirA ligase to DDB_G0277179 to biotinylate proximal proteins.

  • Fluorescence Resonance Energy Transfer (FRET): For studying dynamic interactions in living Dictyostelium cells.

  • Co-immunoprecipitation: Using specific antibodies against DDB_G0277179 or epitope tags.

Data analysis approach:

  • Compare interaction profiles under different physiological conditions

  • Validate key interactions with multiple methodologies

  • Use bioinformatic tools to predict interaction domains

  • Perform domain mapping to identify specific regions responsible for interactions

These methodologies should be selected based on the specific research question and available resources .

How can I resolve expression and solubility issues with recombinant DDB_G0277179?

When encountering expression or solubility issues with DDB_G0277179:

Common Issues and Solutions:

ProblemPotential CausesTroubleshooting Approaches
Low expression yieldCodon bias, toxicity to hostTry codon optimization, use reduced temperatures, test different promoters
Protein insolubilityMisfolding, hydrophobic regionsExpress as fusion with solubility tags (MBP, SUMO), test detergents for membrane-associated regions
Protein degradationHost proteases, intrinsic instabilityAdd protease inhibitors, express in protease-deficient strains, reduce expression temperature
Inclusion body formationRapid expression, misfoldingReduce induction temperature to 16-20°C, co-express with chaperones
Loss during purificationBuffer incompatibility, aggregationTest various buffer systems with different pH and salt concentrations

Refolding Strategy:
If the protein forms inclusion bodies despite optimization attempts, consider a denaturation and refolding approach:

  • Solubilize inclusion bodies in 8M urea or 6M guanidine-HCl

  • Perform stepwise dialysis to remove denaturant

  • Add appropriate redox reagents (glutathione) to facilitate disulfide bond formation

  • Use additives like L-arginine to prevent aggregation during refolding

What analytical methods should I use to confirm the structural integrity of purified DDB_G0277179?

To verify the structural integrity of purified DDB_G0277179:

Primary structure verification:

  • Mass spectrometry (MS) to confirm exact molecular weight

  • Peptide mapping and sequencing after protease digestion

Secondary structure analysis:

  • Circular dichroism (CD) spectroscopy to assess α-helix and β-sheet content

  • Fourier transform infrared spectroscopy (FTIR) for complementary structural information

Tertiary structure assessment:

  • Intrinsic fluorescence spectroscopy to evaluate tryptophan environments

  • Limited proteolysis to probe domain organization and folding

  • Differential scanning calorimetry (DSC) to measure thermal stability

Quaternary structure determination:

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

  • Analytical ultracentrifugation (AUC) for precise molecular weight and shape information

Activity assays:
If bacteriolytic activity is suspected (based on similar proteins like BadA), perform bacterial lysis assays at acidic pH (approximately pH 2) mimicking phagosomal conditions, using Klebsiella pneumoniae as a substrate .

How can contradictory experimental results regarding DDB_G0277179 function be reconciled?

When faced with contradictory results regarding DDB_G0277179 function:

Systematic Reconciliation Approach:

  • Evaluate experimental conditions:

    • Compare pH conditions used across studies (critical for bacteriolytic activity)

    • Assess protein concentrations and buffer compositions

    • Review cell types and genetic backgrounds used

  • Assess protein integrity:

    • Verify full-length vs. partial protein constructs used

    • Examine post-translational modifications present in different expression systems

    • Consider tag interference with function

  • Experimental validation strategies:

    • Perform domain swapping or mutation analysis to identify functional regions

    • Use complementation studies in knockout strains to verify in vivo function

    • Compare results across multiple orthogonal assays

  • Contextual considerations:

    • Evaluate potential redundancy with related family members

    • Consider developmental stage-specific functions in Dictyostelium

    • Assess environmental factors that might influence protein function

A comprehensive assessment following this framework can help reconcile apparently contradictory results by identifying condition-specific functions or technical variables affecting experimental outcomes .

What are promising research avenues for elucidating the biological role of UPF0420 protein in Dictyostelium?

Based on current knowledge gaps, these research directions show particular promise:

  • Comprehensive phenotypic characterization of DDB_G0277179 knockout strains:

    • Evaluate growth rates, development, and resistance to various bacterial pathogens

    • Perform transcriptomic and proteomic analyses to identify affected pathways

    • Assess cellular functions such as phagocytosis, phagosome maturation, and bacteria killing

  • Structural biology approaches:

    • Solve the crystal structure of DDB_G0277179 to gain insights into potential functions

    • Perform structure-guided mutagenesis to identify catalytic sites

    • Use new computational methods like RFdiffusion for structure prediction and analysis

  • Comparative analysis with related proteins:

    • Investigate functional overlap with the Bad family proteins (BadA, BadB, BadC)

    • Examine if DDB_G0277179 possesses bacteriolytic activity similar to Bad proteins

    • Study evolutionary relationships across Dictyostelium species and other amoebae

  • Interactome mapping:

    • Identify binding partners during different developmental stages

    • Characterize the protein's localization in cellular compartments across conditions

    • Investigate potential roles in signaling pathways

This multifaceted approach would significantly advance our understanding of this poorly characterized protein family .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.