Recombinant Dictyostelium discoideum Zinc finger protein-like 1 homolog (zfpl1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
zfpl1; DDB_G0276489; Zinc finger protein-like 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Dictyostelium discoideum (Slime mold)
Target Names
zfpl1
Target Protein Sequence
MGICKCKKRSEDFCFNHKKFICDSCVVADHSICYIKSYVSWLTDCEFEDSVCGVCKGKFD VDDNDDSVRLLCYHLYHPECIDVYVAALPQNSSVESYPCPKCPEPILPSNDKQSLLANSI RDRFSVSSWAGDYLKSFKKQNSNSNNNNNDNNNPKSNGITNGINGTHINNATSPEFYTNL DSIKSNGIHHHHHHSNNSNNNNIINPSLLEETPPLSHLNSNPYGLASRKHEHEDTVIQLN SGTNSNISNNIHGNNKIYDDDYDKYNKRPVNPISKIINNIKETKPKYLIMITVAIIVFLI LISKMGSNSDSNDNIVGDNNNNNNNININNDNNGGNGAINEETLNDQKIPNNGQ
Uniprot No.

Target Background

Database Links
Protein Families
ZFPL1 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the structural organization of zinc finger proteins in Dictyostelium discoideum?

Zinc finger proteins in Dictyostelium discoideum, like their mammalian counterparts, are characterized by conserved structural domains that coordinate zinc ions. The most studied include GtaC (a GATA-type zinc-finger transcription factor) and TtpA, which contains a conventional RNA-binding TZF (tandem zinc finger) domain . TtpA specifically contains a typical TZF domain with correct internal spacing and conserved residues, alongside a predicted C-terminal CNOT1 binding (CNB) domain . These zinc finger domains represent the most conserved parts of these proteins, suggesting their functional importance in DNA or RNA binding .

How does the developmental expression pattern of zinc finger proteins vary in Dictyostelium discoideum?

Zinc finger proteins in Dictyostelium exhibit temporally distinctive binding patterns that correspond with developmental stages. For example, GtaC shows dynamic DNA-binding profiles that align with each developmental transition as Dictyostelium progresses from unicellular amoebae to a multicellular organism . The expression and binding activity of these proteins often correlate with developmental gene regulation, playing essential roles in decoding extracellular signals (such as cAMP pulses) during early development and potentially mediating cell-type differentiation in later stages .

What expression systems yield optimal results for recombinant Dictyostelium zinc finger proteins?

For recombinant expression of Dictyostelium zinc finger proteins, several systems have been successfully employed by researchers. When expressing these proteins, it's critical to ensure proper folding and zinc coordination. Based on studies with similar proteins, bacterial expression systems using E. coli strains specifically designed for proteins containing disulfide bonds (such as Origami or SHuffle strains) can be effective when supplemented with zinc in the growth medium. For more complex zinc finger proteins, eukaryotic expression systems including yeast or insect cells may provide better results due to their enhanced post-translational modification capabilities.

The expression construct design should include:

  • Appropriate affinity tags (His-tag or GST) for purification

  • Protease cleavage sites for tag removal

  • Codon optimization for the expression host

  • Signal sequences if secretion is desired

Expression SystemAdvantagesLimitationsRecommended Applications
E. coliHigh yield, economicalLimited post-translational modificationsSimple zinc finger domains
YeastBetter folding, moderate yieldLonger production timeComplex multi-domain proteins
Insect cellsExcellent folding, high yieldMore expensive, complex setupFull-length proteins requiring authentic folding
Dictyostelium itselfNative modificationsLower yieldProteins requiring specific Dictyostelium modifications

What purification strategies maximize yield and activity of recombinant Dictyostelium zinc finger proteins?

Purification of zinc finger proteins requires special considerations to maintain structural integrity and DNA/RNA binding activity. Based on research with similar proteins, a multi-step purification approach is recommended:

  • Initial capture using affinity chromatography (Ni-NTA for His-tagged proteins)

  • Buffer optimization with 50-100 μM ZnCl₂ throughout purification to maintain zinc coordination

  • Ion exchange chromatography to remove DNA contaminants that may co-purify with DNA-binding proteins

  • Size exclusion chromatography as a final polishing step

  • Verification of zinc content using atomic absorption spectroscopy or colorimetric assays

Critical buffer considerations include:

  • Inclusion of reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol)

  • Avoiding strong chelating agents (EDTA) that may strip zinc

  • pH range of 7.0-8.0 to maintain stability

  • Glycerol (10-20%) to prevent aggregation during storage

How can researchers verify proper folding and activity of purified recombinant zinc finger proteins?

Proper folding and functional activity assessment of recombinant zinc finger proteins from Dictyostelium should include multiple complementary approaches:

  • Circular dichroism (CD) spectroscopy to assess secondary structure elements

  • Thermal shift assays to evaluate stability and proper folding

  • DNA/RNA binding assays:

    • Electrophoretic mobility shift assays (EMSA) for DNA-binding zinc fingers

    • RNA binding assays for RNA-binding zinc fingers like TtpA

  • Functional assays based on specific protein activity:

    • For TtpA, assess binding to AU-rich elements in target mRNAs

    • For GtaC, evaluate binding to GATA-type sequences in regulatory elements

The TtpA protein from Dictyostelium provides a useful example - it contains a TZF domain that binds to AU-rich elements in target mRNAs. When TtpA function was disrupted, cells exhibited large increases in the levels of transcripts containing typical AU-rich TTP family member binding sites in their 3'-UTRs .

What experimental approaches can effectively characterize DNA/RNA binding specificity?

For characterizing the binding specificity of Dictyostelium zinc finger proteins:

  • ChIP-seq (Chromatin Immunoprecipitation followed by sequencing):

    • Provides genome-wide view of in vivo binding sites

    • Has been successfully used for GtaC to identify its direct targets

    • Requires specific antibodies or expression of tagged proteins

  • RNA-based approaches for RNA-binding zinc finger proteins:

    • CLIP-seq (Cross-linking immunoprecipitation) to identify direct RNA targets

    • RNA electrophoretic mobility shift assays

    • In situ hybridization to visualize RNA binding in cellular context

  • Mutational analysis:

    • Site-directed mutagenesis of predicted zinc-coordinating residues

    • For example, point mutations in predicted zinc-coordinating residues in the ZFDs (zinc finger domains) of ZFPL1 have been used to determine functional importance

  • Reporter assays:

    • Using 3'-UTR regions of target genes fused to reporter constructs

    • The 3'-UTR of sodC mRNA was shown to confer TtpA regulation when fused with a heterologous mRNA, but mutations in the core TTP-binding motif abrogated such control

How do zinc finger proteins regulate developmental transitions in Dictyostelium discoideum?

Zinc finger proteins play critical roles in orchestrating developmental transitions in Dictyostelium. GtaC specifically serves as a key transcription factor that exhibits temporally distinctive DNA-binding patterns concordant with each developmental stage . This protein is essential for developmental progression, particularly in:

  • Decoding extracellular cAMP pulses during early development

  • Potentially mediating cell-type differentiation at later stages

  • Regulating multiple physiological processes as Dictyostelium transitions from unicellular amoebae to an integrated multicellular organism

The developmental program in Dictyostelium includes chemotaxis, multicell formation, cytodifferentiation, morphogenesis, and ultimately terminal differentiation into the mature fruiting body with stalk/cup cells and spores . Zinc finger proteins are integral to this complex process, helping coordinate gene expression changes necessary for these morphological and functional transitions.

What signaling pathways interact with zinc finger proteins during Dictyostelium development?

Zinc finger proteins in Dictyostelium integrate with several signaling pathways:

How do mutations in zinc finger domains affect protein function in Dictyostelium?

Mutations in zinc finger domains can significantly impact protein function in Dictyostelium. Research with related zinc finger proteins has demonstrated:

  • Point mutations in predicted zinc-coordinating residues can abolish protein function:

    • RNAi rescue experiments with ZFPL1 containing point mutations in zinc-coordinating residues showed that both zinc finger domains are functionally important

    • Mutations in the first domain, which contains the GM130-binding site, or the second domain (a predicted ring finger) impaired protein function

  • Structural implications:

    • Mutations often disrupt the three-dimensional structure of the zinc finger

    • This can prevent proper DNA/RNA binding or protein-protein interactions

    • For example, zinc finger mutations in ZFPL1 that affected GM130 binding also impaired cis-Golgi assembly and function

  • Developmental consequences:

    • When TtpA function was disrupted in D. discoideum, cells exhibited large increases in the levels of specific transcripts

    • This demonstrates how disruption of zinc finger function leads to dysregulation of target genes

What methodological approaches can resolve contradictory findings regarding zinc finger protein function?

When faced with contradictory findings regarding zinc finger protein function in Dictyostelium research, several methodological approaches can help resolve discrepancies:

  • Complementary technical approaches:

    • Combine genomic (ChIP-seq), transcriptomic (RNA-seq), and proteomic approaches

    • Use both in vitro binding assays and in vivo functional studies

    • Apply both gain-of-function and loss-of-function experiments

  • Temporal resolution studies:

    • Analyze protein function at different developmental timepoints

    • GtaC shows temporally distinctive DNA-binding patterns at different developmental stages, suggesting function may vary over time

  • Domain-specific analysis:

    • Create domain-specific mutations rather than complete knockouts

    • For example, separately mutate individual zinc finger domains to distinguish their specific functions

    • ZFPL1 research demonstrated that mutations in different ZFDs had distinct functional consequences

  • Strain and experimental condition standardization:

    • Use consistent Dictyostelium strains and growth conditions

    • Report detailed experimental conditions to facilitate reproducibility

    • Consider how differences in experimental setup might explain contradictory results

How can genome editing techniques be optimized for studying zinc finger protein function?

CRISPR-Cas9 and other genome editing approaches can be optimized for studying zinc finger protein function in Dictyostelium through the following strategies:

  • Design considerations for zinc finger genes:

    • Target highly conserved regions of zinc finger domains

    • Design multiple guide RNAs to increase editing efficiency

    • Avoid regions with potential off-target effects

  • Domain-specific modifications:

    • Create precise domain deletions or modifications rather than whole gene knockouts

    • Generate point mutations in zinc-coordinating residues

    • Introduce epitope tags for immunoprecipitation and visualization

  • Functional replacement strategies:

    • Design knock-in constructs that replace native zinc finger proteins with modified versions

    • Create chimeric proteins to study domain function

    • Implement inducible expression systems for temporal control

  • Validation approaches:

    • Verify edits by sequencing and protein expression analysis

    • Confirm functional consequences using appropriate assays

    • Perform rescue experiments with wild-type protein to confirm specificity

What comparative approaches yield insights into evolutionary conservation of zinc finger protein function?

Comparative analysis of zinc finger proteins across evolutionary groups provides valuable insights into functional conservation and specialization:

  • Phylogenetic analysis across Dictyostelium species:

    • The dictyostelids can be placed into four evolutionary groups

    • Group 4 (including D. discoideum) is thought to have evolved most recently

    • Comparing zinc finger protein sequences and functions across these groups can reveal evolutionary adaptations

  • Domain architecture comparison:

    • Analyze conservation of specific zinc finger domains

    • For TtpA, comparison with representatives from groups 1-3 showed strong conservation of the TZF domain

    • This conservation suggests fundamental functional importance

  • Binding site conservation analysis:

    • Compare DNA/RNA binding motifs recognized by homologous zinc finger proteins

    • Identify conserved versus divergent target sequences

    • Map changes in binding specificity to structural differences

  • Functional complementation experiments:

    • Test whether zinc finger proteins from different species can rescue mutant phenotypes

    • Express mammalian zinc finger proteins in Dictyostelium mutants

    • Such experiments can reveal functional equivalence despite sequence divergence

What strategies can overcome common challenges in recombinant zinc finger protein expression?

Researchers frequently encounter challenges when expressing recombinant zinc finger proteins from Dictyostelium. Here are evidence-based solutions:

  • Addressing protein insolubility:

    • Optimize growth temperature (often 16-18°C improves folding)

    • Include zinc supplementation (50-100 μM ZnCl₂) in growth media

    • Use solubility-enhancing fusion partners (SUMO, MBP, or TrxA)

    • Try auto-induction media instead of IPTG induction

  • Maintaining protein stability:

    • Include glycerol (10-20%) and reducing agents in all buffers

    • Add zinc ions to stabilize the zinc finger structure

    • Consider stabilizing mutations based on structural analysis

    • Use protease inhibitors throughout purification

  • Improving functional activity:

    • Ensure proper protein refolding if purifying from inclusion bodies

    • Verify zinc incorporation using zinc-specific assays

    • Optimize buffer conditions (pH, salt, additives) through thermal shift assays

    • Perform activity tests immediately after purification

  • Addressing low expression:

    • Optimize codon usage for expression host

    • Try different promoter systems

    • Test multiple fusion tags and their positions (N- vs C-terminal)

    • Consider co-expression with chaperones to improve folding

How can researchers design definitive experiments to establish zinc finger protein function in developmental pathways?

To establish definitive causal relationships between zinc finger proteins and developmental pathways in Dictyostelium:

  • Genetic approach:

    • Generate clean knockouts using CRISPR-Cas9

    • Create conditional knockout systems for essential genes

    • Perform precise domain mutations rather than complete knockouts

    • Implement complementation tests with mutant variants

  • Temporal regulation analysis:

    • Use serial ChIP-seq and RNA-seq analyses at different developmental timepoints

    • This approach successfully revealed GtaC's dynamic binding patterns during development

    • Identify direct targets and observe cotemporaneous binding and expression regulation

  • Target validation:

    • Perform reporter assays with wild-type and mutated binding sites

    • As demonstrated with TtpA, where the 3'-UTR of a target gene conferred regulation, but mutations in the binding site prevented it

    • Use CRISPR to mutate endogenous binding sites in target genes

  • Multi-level analysis:

    • Integrate transcriptomic, proteomic, and phenotypic data

    • Track changes across developmental stages

    • Establish causality through intervention experiments

    • Use rescue experiments with precise timing to determine critical periods

What analytical approaches best characterize zinc finger protein interactions with other cellular components?

To comprehensively characterize interactions between zinc finger proteins and other cellular components:

  • Protein-protein interaction analysis:

    • Co-immunoprecipitation followed by mass spectrometry

    • Proximity labeling approaches (BioID, APEX)

    • ZFPL1 research demonstrated direct interaction with the cis-Golgi matrix protein GM130 through IP studies

    • Yeast two-hybrid or mammalian two-hybrid screens for systematic interaction mapping

  • Protein-nucleic acid interaction analysis:

    • ChIP-seq for DNA interactions, as used with GtaC

    • CLIP-seq for RNA interactions

    • In vitro binding assays with purified components

    • High-throughput binding assays to determine consensus sequences

  • Subcellular localization studies:

    • Fluorescent protein tagging for live-cell imaging

    • Co-localization analysis with organelle markers

    • For example, ZFPL1 was shown to localize to the Golgi apparatus

    • Dynamic relocalization studies during developmental transitions

  • Functional interaction networks:

    • Genetic interaction screens (synthetic lethality/enhancement)

    • Computational network analysis integrating multiple data types

    • Pathway analysis based on transcriptomic changes in mutants

    • Perturbation studies to validate network models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.