Recombinant Didelphis marsupialis virginiana 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant HTR1B is produced using multiple heterologous systems to optimize yield and functionality:

Production Systems

HostAdvantagesApplications
E. coliCost-effective, high yieldStructural studies
BaculovirusPost-translational modifications (e.g., glycosylation)Functional assays
Mammalian CellsNative-like folding and membrane integrationDrug screening

Purification typically involves affinity chromatography, with final storage in Tris-based buffers containing 50% glycerol to maintain stability .

Regulatory Regions and Polymorphisms

The 3′ untranslated region (UTR) of HTR1B contains SNPs (e.g., rs13212041) that modulate mRNA stability and miRNA interactions. Experimental truncation studies identified critical regulatory sequences between +1953–+2311 bp and +2440–+2769 bp, which affect transcriptional activity in SK-N-SH, HEK-293, and U87 cell lines .

Pharmacological Profiling

While human HTR1B is well-characterized, studies on the opossum variant reveal interspecies differences in ligand selectivity. For example, BRL54443 (a serotonin agonist) shows higher affinity for HTR1E than HTR1F in chickens, suggesting evolutionary divergence in receptor-ligand interactions .

Applications in Research

  • Drug Development: Used to screen serotonin-targeted therapeutics for depression, migraines, and anxiety .

  • Structural Biology: Facilitates cryo-EM and X-ray crystallography studies due to high purity .

  • Evolutionary Studies: Comparative analysis of GPCR conservation across species .

Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles degrade the protein; aliquots stored at -80°C retain functionality for 12 months .

  • Species-Specificity: Functional findings in non-mammalian models (e.g., chickens) may not fully translate to mammalian systems .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Note: All protein shipments are made with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize its development.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-388
Protein Length
full length protein
Species
Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana)
Target Names
Target Protein Sequence
MEQPSRLCSPPASGSLTSSQTNHSTFPNPNCSAPDLEPYQDSIALPWKVLLATFLGLITL GTTLSNAFVIATVSRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVV CDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAGMIIMVWVFSVSIS MPPLFWRQAKAEEVADCSVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQ TPNRTGKRLTRAQLITDSPGSSSSGTSINSRAPEGPSESGSPVYVNQVKVKVSDALLEKK KLMAARERKATRTLGIILGAFIVCWLPFFIISLALPICDDACWFHLAIFDFFNWLGYLNS LINPIIYTKSNDDFKQAFQKLMRFRRTS
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine (serotonin) receptor 1B (HTR1B) is a G-protein coupled receptor found in various mammals, including the Virginia opossum (Didelphis virginiana). It functions as a receptor for serotonin and a range of alkaloids and psychoactive substances. Upon ligand binding, the receptor undergoes a conformational change, activating downstream signaling pathways through guanine nucleotide-binding proteins (G proteins). This signaling modulates the activity of effectors, such as adenylate cyclase, ultimately inhibiting its activity. Members of the arrestin family can inhibit signaling via G proteins and mediate alternative signaling pathways. HTR1B plays a crucial role in regulating the release of serotonin, dopamine, and acetylcholine in the brain, thereby impacting neural activity, nociceptive processing, pain perception, mood, and behavior. Additionally, it contributes to vasoconstriction of cerebral arteries.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of the Didelphis marsupialis HTR1B receptor?

The 5-hydroxytryptamine receptor 1B (5-HT1B) from Didelphis marsupialis virginiana (North American opossum) is a G protein-coupled receptor that belongs to the serotonin receptor family. The receptor functions primarily through inhibitory mechanisms and shares structural homology with other mammalian 5-HT1B receptors. The receptor contains seven transmembrane domains characteristic of the GPCR superfamily, with important binding sites in the transmembrane regions .

The protein structure includes critical amino acid residues in the transmembrane regions that determine ligand binding specificity, with notable differences from human and rodent 5-HT1B receptors. These differences are particularly relevant in the transmembrane region where a single amino acid substitution (Thr335 in humans versus Asn in rodents) affects binding affinity for certain ligands .

How does HTR1B function differ between Didelphis marsupialis and other species?

Species differences in 5-HT1B receptor function are significant and must be considered when designing cross-species studies. While the Didelphis marsupialis HTR1B shares homology with human and rodent 5-HT1B receptors, important pharmacological differences exist. Like other species' 5-HT1B receptors, the Didelphis receptor likely functions as an inhibitory autoreceptor in serotonergic neurons and as a heteroreceptor in non-serotonergic neurons .

What are the optimal storage and reconstitution methods for Recombinant Didelphis marsupialis HTR1B?

For optimal preservation of recombinant Didelphis marsupialis virginiana HTR1B activity, proper storage and reconstitution protocols are essential. The recombinant protein has two storage formats with different shelf-life characteristics:

  • Lyophilized form: Maintains stability for approximately 12 months when stored at -20°C to -80°C .

  • Liquid form: Remains stable for approximately 6 months when stored at -20°C to -80°C .

For reconstitution, follow these methodological steps:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being recommended for optimal stability)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C or -80°C for long-term use

For short-term experiments, working aliquots can be stored at 4°C for up to one week. Importantly, repeated freeze-thaw cycles should be strictly avoided as they significantly compromise protein integrity and activity .

What molecular techniques are recommended for expression system verification when working with Didelphis marsupialis HTR1B?

When working with recombinant Didelphis marsupialis HTR1B, verification of proper expression is critical. The recommended molecular techniques include:

  • SDS-PAGE analysis: The purity of the recombinant protein should be >85% as determined by SDS-PAGE . This technique allows verification of protein size and preliminary purity assessment.

  • PCR-based verification: Using specific primers targeting the HTR1B gene region, similar to approaches used in related research. For amplification and verification, researchers can design primers following the stringent performance standards outlined in the MIQE guidelines (minimum information for publication of quantitative real-time PCR experiments) .

  • Sequencing verification: The V7V8 region of 18S ribosomal RNA gene could be utilized as a verification method for species identification, as demonstrated in related opossum research .

  • Functional verification: Binding assays with known 5-HT1B ligands should be performed to confirm that the expressed protein maintains proper folding and function.

The verification process should include appropriate controls to ensure specificity, including DNA contamination controls when using PCR-based methods .

How should researchers design binding assays to characterize ligand interactions with Didelphis marsupialis HTR1B?

When designing binding assays for Didelphis marsupialis HTR1B, researchers should implement a systematic approach that accounts for the unique properties of this marsupial receptor:

Methodological Protocol:

  • Selection of appropriate radioligands: Use well-characterized 5-HT1B ligands such as [³H]GR125,743 or [³H]5-HT that have demonstrated cross-species binding. Establish saturation binding curves to determine Kd and Bmax values specific to the opossum receptor.

  • Competition binding assays: To characterize the receptor's pharmacological profile, competition assays should be performed with:

    • Endogenous ligand (serotonin)

    • Known 5-HT1B agonists (sumatriptan, zolmitriptan)

    • Known 5-HT1B antagonists (GR127,935, SB216641)

    • Compounds that differentiate 5-HT1B from 5-HT1D (as these receptors have similar pharmacological profiles)

  • Binding buffer optimization: Since the marsupial receptor may have different optimal conditions than human or rodent receptors, systematically test:

    • pH range (7.0-7.6)

    • Buffer composition (HEPES vs. Tris)

    • Ion concentrations (particularly Mg²⁺ and Ca²⁺)

    • Temperature (4°C, 25°C, 37°C)

  • Species comparative analysis: Always include human and rodent 5-HT1B receptors as reference points in parallel assays to identify species-specific binding characteristics.

Data Analysis Considerations:

Researchers should fit binding data to appropriate mathematical models (one-site binding, two-site binding, allosteric interactions) and compare the results across species to identify unique characteristics of the Didelphis marsupialis HTR1B receptor.

What are the critical controls needed when conducting functional studies with recombinant Didelphis marsupialis HTR1B?

When conducting functional studies with recombinant Didelphis marsupialis HTR1B, implementing appropriate controls is essential for data validity and interpretation:

Essential Experimental Controls:

  • Positive Control Systems:

    • Human or rat 5-HT1B receptor preparations with well-established functional responses

    • Known 5-HT1B agonists with validated efficacy (e.g., sumatriptan)

    • Positive control for signal transduction pathway being measured (e.g., forskolin for cAMP studies)

  • Negative Control Systems:

    • Mock-transfected cells lacking HTR1B expression

    • Non-receptor-expressing tissue preparations

    • Selective 5-HT1B antagonists to confirm receptor specificity

  • Pharmacological Validation Controls:

    • Concentration-response curves for reference compounds

    • Time-course studies to establish optimal assay windows

    • Selective compounds that differentiate 5-HT1B from the closely related 5-HT1D receptor

  • Technical Quality Controls:

    • DNA contamination controls when using PCR-based detection methods

    • Vehicle controls for all test compounds

    • Internal standards for normalization of responses

  • Species-Specific Considerations:

    • Include parallel testing of human HTR1B to identify species differences

    • Consider the single amino acid differences in the transmembrane region that cause pharmacological variation between species

Researchers should document receptor expression levels across experimental conditions, as variations in receptor density can significantly impact functional responses, particularly when comparing across species or expression systems.

How do the pharmacological properties of Didelphis marsupialis HTR1B compare to human HTR1B?

The pharmacological properties of Didelphis marsupialis HTR1B compared to human HTR1B show important differences that researchers must consider when designing experiments and interpreting results:

Comparative Pharmacological Profile:

PropertyDidelphis marsupialis HTR1BHuman HTR1BSignificance for Research
Amino Acid SequenceContains marsupial-specific residues in transmembrane domainsReference sequence with Thr335 in transmembrane regionAffects binding pocket structure and ligand interactions
Agonist PotencyMay show species-specific potency patternsWell-characterized for clinical compoundsExtrapolation from marsupial to human requires validation
Antagonist SelectivityLikely different binding affinities for selective compoundsFew compounds can selectively differentiate 5-HT1B from 5-HT1DSpecies differences may reveal new pharmacophore insights
G-protein CouplingUnknown if coupling efficiency differsCouples primarily to Gi/o proteinsMay affect downstream signaling pathways
DistributionExpected in serotonergic neurons and vascular tissuesPresent in brain, vascular tissue, particularly cerebral arteriesComparative distribution studies needed

Similar to the rodent 5-HT1B receptors, which differ from human receptors due to a single amino acid substitution in the transmembrane region (Thr335 is replaced by Asn in rodents), the Didelphis HTR1B likely has critical amino acid differences that affect pharmacological responses . These differences can be leveraged to better understand structure-function relationships of the receptor.

Researchers should conduct detailed pharmacological profiling of the Didelphis HTR1B before using it as a model for human receptor function, as assumptions based on sequence homology alone may be misleading.

What evolutionary insights can be gained from studying the Didelphis marsupialis HTR1B compared to eutherian mammals?

Studying the Didelphis marsupialis HTR1B receptor provides valuable evolutionary insights into serotonergic system development across mammalian lineages:

Evolutionary Significance:

  • Divergence Timing: Marsupials and eutherians diverged approximately 160 million years ago, making comparative HTR1B analysis a window into conserved versus adapted receptor functions. Amino acid residues conserved between Didelphis and human HTR1B likely represent functionally critical elements that withstood evolutionary pressure.

  • Receptor Subtype Specialization: The 5-HT1B and 5-HT1D receptors share similar pharmacological profiles in humans, with few selective compounds able to differentiate between them . Comparing these receptors across marsupial and eutherian lineages can reveal how receptor subtype specialization evolved.

  • Environmental Adaptation: Differences in the marsupial HTR1B may reflect adaptations to distinct ecological niches and physiological requirements, particularly regarding:

    • Stress response systems

    • Cardiovascular regulation

    • Behavioral modulation

  • Methodological Approach for Evolutionary Analysis:

    • Phylogenetic tree construction based on HTR1B sequences across species

    • Identification of positively selected amino acid residues

    • Homology modeling to visualize structural consequences of evolutionary changes

    • Functional testing of ancestral receptor reconstructions

  • Translational Relevance: Understanding the evolutionary trajectory of HTR1B can inform drug development by identifying highly conserved binding sites (potential targets) versus species-variable regions (potential sources of side effects).

Researchers investigating the evolutionary aspects should employ comparative genomics approaches and molecular clock analyses to estimate divergence rates for the HTR1B gene compared to neutral genetic markers.

How can researchers differentiate between 5-HT1B and 5-HT1D receptor functions when studying Didelphis marsupialis samples?

Differentiating between 5-HT1B and 5-HT1D receptor functions in Didelphis marsupialis samples presents a significant challenge due to their pharmacological similarities, similar to what is observed in human receptors . Researchers should implement a multi-faceted approach:

Methodological Differentiation Strategy:

  • Selective Pharmacological Tools:

    • Utilize the limited number of selective compounds: Only one known agonist and a handful of antagonists can differentiate between 5-HT1B and 5-HT1D in humans

    • Test whether these selective compounds maintain their selectivity in Didelphis receptors

    • Develop a pharmacological fingerprint based on a panel of compounds with varying selectivity ratios

  • Molecular Approaches:

    • Design receptor subtype-specific primers for RT-PCR quantification

    • Implement the PCR-sequencing approach targeting the V7V8 region of 18S rRNA gene for molecular characterization

    • Use subtype-specific antibodies (if available) for immunological differentiation

  • Expression Pattern Analysis:

    • Map the anatomical distribution of each receptor subtype in Didelphis tissues

    • Compare with known distribution patterns in other species

    • Identify tissues with predominant expression of one receptor subtype

  • Functional Assay Selection:

    • Measure multiple signaling pathways downstream of receptor activation

    • Exploit potential differences in signal transduction efficiency

    • Analyze receptor internalization and desensitization kinetics, which may differ between subtypes

  • Knockout/Knockdown Approaches:

    • Use siRNA or CRISPR-based approaches to selectively suppress one receptor subtype

    • Validate knockdown efficiency using RT-qPCR following MIQE guidelines

    • Measure functional responses before and after knockdown

This differentiation is particularly important because therapeutics, such as anti-migraine drugs, often bind to both subtypes to exert their effects , making it challenging to attribute specific physiological responses to individual receptor subtypes.

What signaling pathways are activated by Didelphis marsupialis HTR1B and how do they compare with other species?

The signaling pathways activated by Didelphis marsupialis HTR1B likely share core mechanisms with other mammalian 5-HT1B receptors, but may exhibit species-specific variations in coupling efficiency and downstream effects:

Signaling Pathway Comparison:

Signaling PathwayExpected Didelphis HTR1B ResponseComparison with Human HTR1BExperimental Approach
Gi/o Protein CouplingInhibition of adenylyl cyclase leading to decreased cAMPPrimary signaling mechanismMeasure cAMP levels using ELISA or reporter systems
Inhibition of Neurotransmitter ReleaseInhibition of serotonin (autoreceptor) and other neurotransmitters (heteroreceptor)Controls release of serotonin, acetylcholine, glutamate, GABA, and noradrenaline Neurotransmitter release assays in appropriate cell types
MAPK Pathway ActivationERK1/2 phosphorylation via Gβγ subunitsSecondary pathway activated in specific contextsWestern blot for phosphorylated ERK1/2
Ion Channel ModulationProbable K+ channel activation and Ca2+ channel inhibitionEffects on neuronal excitabilityElectrophysiological recordings
β-Arrestin RecruitmentReceptor internalization and desensitizationRegulates receptor availabilityBRET or FRET-based interaction assays

Methodological Considerations:

  • To properly characterize these pathways, researchers should:

    • Compare signaling in native tissue versus recombinant systems

    • Examine temporal dynamics of pathway activation

    • Assess pathway crosstalk and integration

  • The cardiovascular effects of 5-HT1B activation, particularly vasoconstriction in cerebral arteries , should be investigated in Didelphis to determine if this response is conserved across species. This has particular relevance for understanding the evolutionary conservation of anti-migraine drug mechanisms.

  • Species differences in signaling efficiency may correlate with the ecological and physiological adaptations of marsupials compared to placental mammals.

How should researchers address species-specific data contradictions when comparing Didelphis marsupialis HTR1B with human HTR1B?

When confronted with contradictory data between Didelphis marsupialis HTR1B and human HTR1B, researchers should implement a systematic troubleshooting and analysis approach:

Methodological Framework for Resolving Data Contradictions:

  • Verify Receptor Identity and Purity:

    • Confirm protein integrity of the recombinant Didelphis HTR1B (>85% purity by SDS-PAGE)

    • Re-sequence the receptor to confirm the absence of mutations

    • Assess post-translational modifications that might differ between expression systems

  • Evaluate Experimental Conditions:

    • Test multiple buffer compositions and pH conditions

    • Vary temperature conditions to identify optimal parameters

    • Control for differences in membrane composition in different expression systems

  • Statistical Analysis Approach:

    • Implement formal statistical tests for species differences

    • Calculate effect sizes rather than just statistical significance

    • Use multivariate analysis to identify patterns in complex datasets

  • Isolate Critical Variables:

    • Systematically modify single amino acids to identify critical residues

    • Create chimeric receptors combining domains from human and Didelphis receptors

    • Test a broader range of ligand concentrations to generate complete pharmacological profiles

  • Reconciliation Framework:

    • Consider the evolutionary context – contradictions may reflect genuine species adaptations

    • Examine whether the contradictions are quantitative (magnitude of effect) or qualitative (direction of effect)

    • Determine if different assay systems might explain apparent contradictions

Data Interpretation Guidelines:

When publishing results showing species differences, researchers should clearly distinguish between experimental artifacts and true biological differences. The single amino acid difference in the transmembrane region known to cause pharmacological variation between human and rodent 5-HT1B receptors serves as a precedent for how small genetic differences can lead to significant functional consequences .

What computational methods are recommended for modeling ligand interactions with Didelphis marsupialis HTR1B?

For modeling ligand interactions with Didelphis marsupialis HTR1B, researchers should implement a comprehensive computational approach that accounts for species-specific structural features:

Recommended Computational Workflow:

  • Homology Model Construction:

    • Build models based on crystal structures of human 5-HT1B (PDB IDs: 4IAR, 4IAQ, 5V54)

    • Incorporate Didelphis-specific amino acid substitutions with careful attention to transmembrane regions

    • Validate model quality using Ramachandran plots, RMSD calculations, and energy minimization

  • Molecular Docking Studies:

    • Use multiple docking algorithms (Glide, AutoDock, GOLD) to reduce method-specific biases

    • Dock a diverse set of known 5-HT1B ligands including:

      • Endogenous ligand (serotonin)

      • Clinical agonists (sumatriptan, zolmitriptan)

      • Selective antagonists

    • Score poses using consensus scoring functions

  • Molecular Dynamics Simulations:

    • Perform extended (>100 ns) simulations of receptor-ligand complexes

    • Analyze binding pocket stability and ligand residence time

    • Compare simulations between Didelphis and human receptors to identify dynamics differences

  • Binding Free Energy Calculations:

    • Implement MM-GBSA or FEP methods to quantify binding affinity

    • Decompose energy contributions to identify key interactions

    • Validate computational predictions with experimental binding data

  • Machine Learning Integration:

    • Develop predictive models for receptor selectivity

    • Identify patterns in structure-activity relationships

    • Use transfer learning approaches to apply human HTR1B data to predictions for Didelphis HTR1B

Visualization and Interpretation:

The computational models should highlight the potential impact of the species-specific variations, particularly focusing on the equivalent of the Thr335 position that causes pharmacological differences between human and rodent receptors . These models can guide the design of selective compounds and help explain species-specific pharmacological profiles.

How can Didelphis marsupialis HTR1B be utilized in evolutionary neuropharmacology studies?

Didelphis marsupialis HTR1B offers unique opportunities for evolutionary neuropharmacology studies due to the marsupial lineage's distinct evolutionary position:

Research Applications in Evolutionary Neuropharmacology:

  • Receptor Evolution Analysis:

    • Compare sequence, structure, and function of HTR1B across monotremes, marsupials, and placental mammals

    • Identify conserved functional domains versus species-adapted regions

    • Reconstruct ancestral receptor sequences to test hypotheses about evolutionary trajectories

  • Pharmacological Diversity Assessment:

    • Create comparative pharmacological profiles across species

    • Identify compounds with species-selective actions

    • Develop an evolutionary framework for predicting drug responses across species

  • Methodological Approach:

    • Use Didelphis HTR1B as a representative of marsupial lineage in multi-species comparative studies

    • Implement parallel screening of drug libraries against HTR1B from multiple species

    • Apply phylogenetic analysis to correlate receptor properties with evolutionary relationships

  • Ecological and Behavioral Correlations:

    • Investigate whether HTR1B functional differences correlate with species-specific behaviors

    • Examine receptor distribution in brain regions associated with species-typical behaviors

    • Test whether environmental adaptations correlate with receptor pharmacology

The Didelphis marsupialis 5-HT1B receptor serves as a valuable evolutionary intermediate between monotremes and placental mammals, offering insights into the evolutionary pressures that shaped serotonergic signaling in mammals. Understanding these evolutionary relationships has profound implications for translational research and comparative psychopharmacology.

What are the methodological considerations when comparing HTR1B function across different mammalian orders?

When comparing HTR1B function across different mammalian orders, including Didelphis marsupialis (order Didelphimorphia), researchers must address several methodological challenges:

Critical Methodological Considerations:

  • Expression System Standardization:

    • Use identical expression systems for all species variants

    • Verify equivalent receptor expression levels using quantitative approaches

    • Control for differences in membrane composition that might affect receptor function

  • Pharmacological Profiling Strategy:

    • Test standardized compound panels across all species

    • Include compounds with known species selectivity

    • Generate full concentration-response curves rather than single-point measurements

  • Functional Assay Selection:

    • Choose assays that measure proximal signaling events to minimize downstream variations

    • Implement multiple complementary assay readouts (cAMP, Ca²⁺, β-arrestin, etc.)

    • Validate assay performance across species with positive controls

  • Statistical Analysis Framework:

    • Use hierarchical statistical models that account for species relationships

    • Implement phylogenetically corrected correlation analyses

    • Calculate standardized effect sizes to facilitate cross-species comparisons

  • Addressing Confounding Variables:

    • Account for differences in receptor reserve across expression systems

    • Control for variation in G-protein and effector availability

    • Consider the influence of different body temperatures (particularly relevant for marsupials)

Experimental Design Table for Cross-Species Comparison:

Experimental ParameterControl StrategyValidation Method
Receptor ExpressionTitrate transfection to achieve equivalent expressionQuantitative Western blot or radioligand binding
Membrane EnvironmentUse consistent cell background or native tissue preparationMeasure membrane fluidity and composition
Assay SensitivityCalibrate each system with reference compoundsDetermine Z-factor for each species assay
Species-Specific FactorsInclude temperature controls matching physiological conditionsMeasure system performance across temperature range
Data NormalizationExpress data relative to maximal system responseValidate with multiple reference compounds

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.