Recombinant Didelphis marsupialis virginiana Alpha-2B adrenergic receptor (ADRA2B)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ADRA2B; Alpha-2B adrenergic receptor; Alpha-2B adrenoreceptor; Alpha-2B adrenoceptor; Alpha-2BAR; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-382
Protein Length
full length protein
Species
Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana)
Target Names
Target Protein Sequence
AIAAVITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANE LLGYWYFRHTWCEVYLALDVLFCTSSIVHLCAISLDRYWSVSRALEYNSKRTPRRIKGII LTVWLIAAFISLPPLIYKGDKGKKPGGRPQCKLNEEAWYILSSSIGSFFAPCLIMILVYL RIYLIAKRRNRQGPHGKQAPGDGDTGPSALGGTSTISKLPPSILPAVGEANGHSKPPGER EGGEQMGDPTSPSTPPNQSSVGPEDGSQKQEEEEEEEEEEEEECGPPAPPTSSSLQGTPN FQPSQGSQVLATLRGQVLLARGPASLGLQPWRRRTQMNREKRFTFVLAVVIGVFVLCWFP FFFSYSLGAICPQHCKVPHGLF
Uniprot No.

Target Background

Function
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRA2B sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Alpha-2B adrenergic receptor from Didelphis marsupialis virginiana and why is it significant for research?

The Alpha-2B adrenergic receptor (ADRA2B) from Didelphis marsupialis virginiana is a G protein-coupled receptor that mediates the catecholamine-induced inhibition of adenylate cyclase through G proteins. This marsupial receptor is significant for comparative studies of adrenergic signaling evolution across mammalian lineages. The receptor contains 382 amino acids and has been assigned UniProt accession number O77715 . Evolutionary studies using this receptor help researchers understand the divergence of adrenergic systems between marsupials and placental mammals, providing insights into the conservation of critical signaling pathways across evolutionary time.

How does the amino acid sequence of opossum ADRA2B differ from other mammalian species?

The opossum ADRA2B protein consists of 382 amino acids with the full sequence available in the product information . Key differences between opossum and other mammalian ADRA2B receptors include:

The distinctive polyglutamate region in the C-terminal domain (EEEEEEEEEECG) is particularly notable as it may influence receptor desensitization and trafficking dynamics compared to placental mammal receptors .

What are the optimal storage and handling conditions for recombinant Didelphis ADRA2B protein?

For optimal stability and activity, the recombinant ADRA2B protein should be stored in Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage . Researchers should avoid repeated freeze-thaw cycles, as these significantly reduce protein activity. Working aliquots can be stored at 4°C for up to one week. The protein is typically supplied at concentrations suitable for direct experimental use (from a standard 50 μg quantity) . When handling, maintain protein samples on ice and minimize exposure to proteases by including appropriate protease inhibitors in experimental buffers.

How can I validate the specificity of antibodies against opossum ADRA2B in immunological studies?

To validate antibodies against opossum ADRA2B:

  • Positive controls: Use purified recombinant opossum ADRA2B protein in Western blot analysis to confirm antibody binding at the expected molecular weight (approximately 45-50 kDa depending on glycosylation state) .

  • Negative controls: Test antibody against tissue samples from ADRA2B knockout models or use pre-immune serum as control.

  • Cross-reactivity assessment: Perform parallel testing with recombinant ADRA2B proteins from other species (rat, mouse, human) to evaluate specificity across species, similar to approaches used for other receptor studies .

  • Immunohistochemistry validation: Compare staining patterns with known ADRA2B expression profiles in opossum tissues, focusing on tissues with established adrenergic signaling.

  • Peptide competition: Pre-incubate antibodies with specific peptides from the opossum ADRA2B sequence to demonstrate binding specificity.

This systematic validation approach ensures reliable immunodetection results for comparative studies across species.

What expression systems are most effective for producing functional recombinant opossum ADRA2B?

Based on receptor expression research methodologies, the following expression systems offer distinct advantages for opossum ADRA2B production:

Expression SystemAdvantagesLimitationsYield
HEK293 cellsMammalian post-translational modifications; effective membrane traffickingHigher cost; slower growthModerate (0.5-2 mg/L)
Sf9/Sf21 insect cellsHigher expression levels; efficient for GPCRsDifferent glycosylation patternsHigh (2-5 mg/L)
Pichia pastorisCost-effective; high-density culturesLimited post-translational modificationsVariable (1-4 mg/L)
E. coli (inclusion bodies)Highest yields; economicalRequires refolding; lacks modificationsVery high (5-10 mg/L)

For functional studies requiring native receptor conformation, mammalian or insect cell expression systems are recommended as they provide proper receptor folding and post-translational modifications crucial for ligand binding. Additionally, fusion tags (His-tag, FLAG-tag) can facilitate purification while minimizing interference with receptor function .

What methods can be used to assess the functional activity of recombinant opossum ADRA2B?

Multiple complementary approaches can be employed to evaluate the functional activity of recombinant opossum ADRA2B:

  • Ligand binding assays: Using radiolabeled ligands (such as [³H]-clonidine or [³H]-yohimbine) to determine binding affinity (Kd) and receptor density (Bmax).

  • GTPγS binding assay: Measures G-protein activation upon ligand binding to the receptor.

  • cAMP inhibition assay: Since Alpha-2B receptors inhibit adenylyl cyclase, measuring decreases in cAMP production following stimulation with forskolin provides functional readout.

  • BRET/FRET assays: For real-time monitoring of receptor-G protein interactions or receptor conformational changes.

  • Beta-arrestin recruitment: Evaluates receptor desensitization mechanisms using bioluminescence-based assays.

  • Calcium flux assays: When coupled to chimeric G proteins, can provide a convenient optical readout of receptor activation.

When comparing opossum ADRA2B to orthologs from other species, parallel assays should be conducted under identical conditions to identify potential functional differences in receptor pharmacology or signaling kinetics.

How does the structure of opossum ADRA2B compare to human and rodent orthologs?

Structural comparison between opossum ADRA2B and its mammalian orthologs reveals several key differences:

  • Transmembrane domains: The seven transmembrane helices show high conservation (>80% similarity), particularly in residues that form the ligand-binding pocket.

  • Extracellular loops: The second extracellular loop (ECL2) of opossum ADRA2B contains unique residues that may influence ligand selectivity compared to human and rodent receptors.

  • Intracellular regions: The third intracellular loop (ICL3) and C-terminal domain show greater divergence across species, potentially affecting G-protein coupling efficiency and downstream signaling.

  • N-glycosylation sites: Opossum ADRA2B contains potential N-glycosylation sites at positions that differ from human and rodent orthologs, which may influence receptor stability and trafficking.

These structural differences provide valuable insights for researchers using opossum ADRA2B as a comparative model for adrenergic receptor evolution and function across mammalian lineages .

What molecular techniques can be used to study opossum ADRA2B expression patterns in different tissues?

Several complementary molecular techniques can be employed to characterize opossum ADRA2B expression patterns:

  • Quantitative PCR (qPCR): Design specific primers for opossum ADRA2B (similar to approaches used for rat and mouse ADRA2B as described in search result ). For accurate quantification, primers should be validated for specificity using melt curve analysis and sequencing of amplicons.

  • RNA-Seq: Provides comprehensive transcriptome analysis across multiple tissues to identify relative expression levels of ADRA2B and potential splicing variants.

  • In situ hybridization: Allows visualization of mRNA expression within tissue context, particularly useful for examining receptor distribution in specific brain regions or other tissues with heterogeneous cell populations.

  • Western blotting: Using validated antibodies against opossum ADRA2B to detect protein expression levels across tissues.

  • Immunohistochemistry/Immunofluorescence: For cellular and subcellular localization of the receptor protein within intact tissue sections.

When designing primers for opossum ADRA2B detection, researchers should target unique regions that differ from other adrenergic receptor subtypes to ensure specificity, similar to the approach used for species identification with cytochrome b primers in Didelphis research .

What are the key considerations when designing ligand binding studies for opossum ADRA2B?

When designing ligand binding studies for opossum ADRA2B, researchers should consider:

  • Ligand selection: Use a combination of selective Alpha-2 agonists (clonidine, UK-14,304) and antagonists (yohimbine, rauwolscine) to characterize pharmacological properties.

  • Species-specific pharmacology: Expected differences in ligand affinities between opossum and other mammalian ADRA2B receptors necessitate complete dose-response curves rather than single-point measurements.

  • Membrane preparation: For consistent results, standardize membrane preparation protocols, controlling for protein concentration and lipid composition.

  • Binding conditions: Optimize buffer composition, pH, temperature, and incubation times specifically for opossum ADRA2B, as these may differ from established protocols for human or rodent receptors.

  • Nonspecific binding determination: Use high concentrations (>100-fold Kd) of non-labeled competing ligands to define nonspecific binding.

  • Data analysis: Apply appropriate mathematical models (one-site vs. two-site binding) to accurately determine binding parameters (Kd, Bmax).

ParameterRecommended Range for Opossum ADRA2BAnalytical Method
pH7.2-7.4Saturation binding
Temperature25°C or 37°CSaturation and competition binding
Incubation time30-60 minutesAssociation/dissociation kinetics
Protein concentration10-50 μg/mLBradford or BCA assay
Radioligand[³H]-Yohimbine (0.1-30 nM)Scintillation counting

How can phylogenetic analysis of ADRA2B from Didelphis marsupialis virginiana inform our understanding of adrenergic receptor evolution?

Phylogenetic analysis of ADRA2B from Didelphis marsupialis virginiana provides valuable insights into adrenergic receptor evolution:

  • Divergence timing: Marsupials like Didelphis diverged from placental mammals approximately 160 million years ago, making their receptors important for understanding ancestral adrenergic signaling systems.

  • Selection pressures: Comparative sequence analysis across mammalian lineages can reveal conserved functional domains under purifying selection versus regions experiencing adaptive evolution.

  • Methodological approach:

    • Align ADRA2B sequences from monotremes, marsupials (including Didelphis), and placental mammals

    • Apply multiple phylogenetic methods (Maximum Likelihood, Bayesian inference)

    • Test for selection using dN/dS ratios in different receptor domains

    • Integrate with physiological data on adrenergic system function across species

  • Evolutionary insights: Analysis of marsupial ADRA2B sequences, similar to approaches used in broader mammalian phylogenetic studies , can reveal whether receptor diversification preceded or followed the therian (marsupial-placental) split.

This phylogenetic framework helps researchers interpret functional differences between marsupial and placental adrenergic receptors in an evolutionary context, potentially revealing adaptive changes related to differences in physiological demands.

What approaches can be used to investigate the role of opossum ADRA2B in parasite-host interactions in Trypanosoma cruzi infections?

Given the evidence of Trypanosoma cruzi infections in Didelphis virginiana , investigating ADRA2B's potential role in this host-parasite interaction represents an intriguing research direction:

  • Expression analysis during infection:

    • Quantify ADRA2B expression changes in infected versus non-infected opossum tissues

    • Correlate expression levels with parasite loads in different tissues and infection stages

  • Functional studies:

    • Evaluate whether T. cruzi infection modulates adrenergic signaling in host cells

    • Assess if pharmacological targeting of ADRA2B affects parasite persistence or replication

  • Comparative approaches:

    • Compare ADRA2B dynamics in resistant versus susceptible opossum populations

    • Analyze receptor polymorphisms potentially associated with infection outcomes

  • Methodological considerations:

    • Use qPCR to quantify both parasite DNA and ADRA2B expression in matched tissue samples

    • Employ immunohistochemistry to visualize receptor distribution in tissues harboring parasites

    • Develop in vitro models using opossum cells expressing ADRA2B to study direct parasite-receptor interactions

This research could reveal previously unknown mechanisms of how neurohormonal signaling influences parasite-host dynamics in reservoir species like Didelphis virginiana, which are epidemiologically relevant for T. cruzi transmission .

What are the challenges and solutions for developing ADRA2B-targeted compounds with species selectivity between marsupial and placental receptor orthologs?

Developing compounds with selectivity between marsupial and placental ADRA2B presents several challenges and potential solutions:

Challenges:

  • High conservation in the orthosteric binding site across mammalian ADRA2B receptors

  • Limited structural data specifically for marsupial adrenergic receptors

  • Differences in allosteric sites that may affect ligand binding kinetics and receptor activation

Solutions and Approaches:

  • Structure-guided design:

    • Generate homology models of opossum ADRA2B based on available crystal structures

    • Perform molecular docking studies to identify unique binding pockets

    • Target regions showing greatest sequence divergence between marsupial and placental receptors

  • High-throughput screening:

    • Develop parallel screening assays using both opossum and human ADRA2B

    • Calculate selectivity indices to identify compounds with species preference

    • Optimize hit compounds through medicinal chemistry for improved selectivity

  • Allosteric modulator development:

    • Focus on allosteric binding sites, which typically show greater sequence divergence than orthosteric sites

    • Screen for positive, negative, or biased allosteric modulators with species selectivity

    • Use site-directed mutagenesis to identify critical residues for selective binding

  • Pharmacological characterization:

    • Compare binding kinetics (kon/koff rates) between species variants

    • Assess signaling profiles across multiple pathways (G-protein vs. β-arrestin)

    • Evaluate potential species differences in receptor desensitization and internalization

This research direction has potential applications in developing selective research tools and understanding fundamental differences in adrenergic pharmacology across mammalian evolution.

What are the optimal protocols for solubilizing and purifying recombinant opossum ADRA2B for structural studies?

Purifying membrane proteins like ADRA2B for structural studies requires specialized approaches:

  • Expression optimization:

    • Use expression systems with high membrane protein yield (Sf9 or HEK293 GnTI- cells)

    • Include affinity tags (His10, FLAG) at the N-terminus or in ICL3 replacement

    • Consider fusion proteins (T4 lysozyme, BRIL) to enhance stability

  • Solubilization strategy:

Detergent ClassExamplesAdvantagesLimitations
MaltosidesDDM, UDMMild, maintain activityLarge micelles
GlucosidesOGGood for crystallizationMore deactivating
Neopentyl glycolsLMNG, MNG-3Enhanced stabilityExpensive
Novel amphipolsA8-35, PMALDetergent-free approachesComplex protocols
  • Purification workflow:

    • Initial solubilization in DDM/CHS mixture (overnight at 4°C)

    • IMAC purification using nickel or cobalt resins

    • Receptor validation via ligand binding

    • Size exclusion chromatography for final polishing

    • Consider lipid reconstitution or nanodiscs for enhanced stability

  • Stability considerations:

    • Include high-affinity ligands during purification

    • Maintain cholesterol hemisuccinate (CHS) throughout

    • Use thermal stability assays to optimize buffer conditions

    • Consider detergent exchange to LMNG for long-term stability

This optimized protocol maximizes the chances of obtaining pure, homogeneous, and functional receptor suitable for structural biology applications such as cryo-EM or crystallization trials.

How can I develop a reliable quantitative PCR assay for opossum ADRA2B expression analysis?

Developing a reliable qPCR assay for opossum ADRA2B requires careful design and validation:

  • Primer design considerations:

    • Design primers spanning exon-exon junctions to prevent genomic DNA amplification

    • Target unique regions of ADRA2B (avoid cross-reactivity with ADRA2A or ADRA2C)

    • Optimal amplicon size: 80-150 bp for efficient amplification

    • Primer pairs should have similar melting temperatures (±1°C)

  • Reference gene selection:

    • Validate multiple reference genes (GAPDH, β-actin, HPRT) in opossum tissues

    • Use geNorm or NormFinder to identify most stable reference genes

    • Consider using at least 3 reference genes for accurate normalization

  • Validation steps:

    • Confirm amplification specificity via melt curve analysis and sequencing

    • Generate standard curves using serial dilutions to determine efficiency (90-110% ideal)

    • Validate primer specificity using tissue panels with known ADRA2B expression patterns

  • Protocol optimization:

    • Test multiple master mixes for optimal performance

    • Determine ideal annealing temperature via gradient PCR

    • Assess reproducibility via technical and biological replicates

  • Data analysis approach:

    • Calculate relative expression using the 2^(-ΔΔCt) method

    • Consider absolute quantification using plasmid standards for precise copy number

This approach, similar to methodologies used for other adrenergic receptor quantification , ensures reliable and reproducible measurement of opossum ADRA2B expression across different experimental conditions.

What bioinformatic tools and approaches are most effective for analyzing evolutionary conservation of functional domains in ADRA2B across marsupial species?

For comprehensive evolutionary analysis of ADRA2B across marsupial species:

  • Sequence acquisition and alignment:

    • Retrieve ADRA2B sequences from available marsupial genomes

    • Use MUSCLE or MAFFT algorithms for accurate multiple sequence alignment

    • Manually refine alignments in transmembrane regions using structural information

  • Conservation analysis tools:

    • ConSurf: Maps conservation scores onto protein structures

    • Sequence Harmony: Identifies subfamily-specific conserved residues

    • FunShift: Detects shifts in functional constraints across lineages

    • PAML: Performs dN/dS analysis to detect selective pressure

  • Structural context integration:

    • Map conservation scores onto homology models

    • Identify functionally important regions (ligand binding, G-protein interaction, phosphorylation)

    • Compare marsupial-specific vs. mammalian-conserved motifs

  • Recommended workflow:

    • Generate comprehensive alignment including monotremes, marsupials, and placentals

    • Perform phylogenetic reconstruction using RAxML or MrBayes

    • Apply branch-site models to test for adaptive evolution

    • Correlate conservation patterns with known functional domains

    • Identify marsupial-specific features for experimental validation

  • Visualization approaches:

    • WebLogo: Create sequence logos highlighting conserved residues

    • PyMOL: Visualize conservation on 3D structures

    • Interactive phylogenetic trees with mapped functional data

This integrated approach, similar to methodologies used in broader mammalian phylogenetic studies , provides insights into how selective pressures have shaped ADRA2B evolution specifically in the marsupial lineage, including Didelphis species.

What are the most promising future research directions for opossum ADRA2B studies?

The most promising future research directions for opossum ADRA2B include:

  • Comparative pharmacology: Systematic comparison of ligand binding properties and signaling profiles between marsupial and placental ADRA2B to identify functional adaptations.

  • Physiological role: Investigation of ADRA2B's role in opossum-specific physiological adaptations, particularly in stress responses, metabolic regulation, and immune function.

  • Host-pathogen interactions: Further exploration of how ADRA2B signaling may influence T. cruzi infections in Didelphis species, building on epidemiological evidence of opossums as important reservoir hosts .

  • Structural biology: Determination of opossum ADRA2B structure using cryo-EM or crystallography to identify unique structural features compared to human orthologs.

  • Development of selective tools: Creation of antibodies, ligands, or genetic constructs specific to opossum ADRA2B to facilitate marsupial adrenergic research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.