Recombinant Didelphis marsupialis virginiana ATP synthase subunit a (MT-ATP6)

What is MT-ATP6 and what is its fundamental role in cellular function?

MT-ATP6 (ATP synthase subunit a) is a critical component of the mitochondrial ATP synthase complex, specifically part of the F₀ domain embedded in the inner mitochondrial membrane. This protein forms part of the proton channel and is essential for the rotary mechanism that drives ATP synthesis. The protein functions by allowing protons to flow through the membrane down their electrochemical gradient, which drives the rotation of the c-ring and ultimately the synthesis of ATP from ADP and inorganic phosphate.

In the North American opossum (Didelphis marsupialis virginiana), MT-ATP6 consists of 226 amino acids and is encoded by the mitochondrial genome . Like other mammalian MT-ATP6 proteins, it plays a fundamental role in cellular bioenergetics and oxidative phosphorylation. Dysfunction of this protein in humans is associated with several mitochondrial disorders, making comparative studies of this protein across species valuable for both evolutionary and biomedical research.

What are the key structural characteristics of Didelphis marsupialis virginiana MT-ATP6?

The MT-ATP6 protein from Didelphis marsupialis virginiana has the following structural characteristics:

• Full protein length: 226 amino acids

• Complete amino acid sequence: MNENLFAPFITPTILGITTLPIIITFPCLILSSPKRWLPNRIQILQMWLIRLITKQMMTMHNKQGRTWTLMLMSLILFIASTNLLGLLPYSFTPTTQLSMNIGMAIPLWAGTVIMGFRNKPKMSLAHFLPQGTPTPLIPMLIIIETISLFIQPLALAVRLTANITAGHLLIHLIGSATLALSSISMTVSTITFSILFLLTLLEIAVAMIQAYVFTLLVSLYLHDNS

• The protein contains multiple transmembrane domains, consistent with its role in forming a proton channel in the inner mitochondrial membrane

• Uniprot accession number: P41313

• Gene symbols and alternative names: MT-ATP6, ATP6, ATPASE6, MTATP6

When produced as a recombinant protein, it typically includes an N-terminal 10xHis-tag to facilitate purification . The protein's hydrophobic nature reflects its membrane-embedded location in vivo, which creates specific challenges for researchers working with the recombinant form.

What expression systems are most effective for producing functional recombinant MT-ATP6?

For the recombinant production of Didelphis marsupialis virginiana MT-ATP6, an E. coli-based expression system has been successfully employed . This approach offers several advantages for membrane proteins:

Bacterial Expression (E. coli):

• Allows for high-yield production

• Enables incorporation of affinity tags (typically N-terminal 10xHis-tag for MT-ATP6)

• Provides controlled induction conditions

• Suitable for full-length expression (amino acids 1-226)

The optimization protocol typically involves:

• Selection of appropriate E. coli strain (often BL21(DE3) or derivatives)

• Codon optimization of the gene sequence for E. coli expression

• Temperature reduction during induction (often to 18-25°C)

• Addition of membrane-protein-specific detergents during extraction

• Purification under conditions that maintain the native folding

Alternative expression systems such as yeast (P. pastoris) or insect cells may offer advantages for preserving post-translational modifications, although these are not typically mentioned in the available data for this specific protein .

What are the optimal storage conditions for maintaining the stability of recombinant MT-ATP6?

Proper storage of recombinant MT-ATP6 is critical for maintaining its structural integrity and functional activity. Based on available information, the following storage recommendations should be considered:

Storage Formats:

• Liquid form: Store at -20°C or preferably -80°C (shelf life: approximately 6 months)

• Lyophilized form: Store at -20°C or -80°C (shelf life: approximately 12 months)

Buffer Considerations:

• The protein is typically stored in a Tris/PBS-based buffer at pH 8.0

• Addition of 6% trehalose serves as a cryoprotectant

• For the liquid form, inclusion of 50% glycerol prevents freeze-thaw damage

Handling Protocol:

• Aliquot the protein upon receipt to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

• For long-term storage, use the -80°C freezer

• When thawing, bring to room temperature slowly on ice to prevent protein denaturation

The stability of the protein is influenced by multiple factors including buffer composition, storage temperature, and the intrinsic stability of the protein itself. Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity .

How can researchers distinguish between MT-ATP6 from Didelphis marsupialis virginiana and closely related opossum species?

Distinguishing between MT-ATP6 proteins from closely related opossum species such as Didelphis marsupialis and Didelphis virginiana requires molecular approaches:

DNA Sequence-Based Differentiation:

• Cytochrome c oxidase subunit I (Cox1) gene sequences can be used as DNA barcodes to differentiate between the two opossum species

• Interspecific distances between D. virginiana and D. marsupialis Cox1 sequences range from 7.8% to 9.3%

• Intraspecific variation is much lower: 1.56% within D. virginiana and 1.65% in D. marsupialis

Protein Sequence Analysis Protocol:

• PCR amplification of the MT-ATP6 gene region

• Sequencing and comparison with reference databases

• Phylogenetic analysis using neighbor-joining (NJ) algorithm with Kimura's two-parameter (K2P) model

• Verification that samples form distinct non-overlapping clusters on NJ trees

This approach has been validated for species identification even in areas where these morphologically similar species occur sympatrically in Mexico . For protein characterization, mass spectrometry analysis can identify species-specific peptide signatures that differentiate between MT-ATP6 proteins from these closely related species.

What evolutionary insights can be gained from studying MT-ATP6 across marsupial species?

Studying MT-ATP6 across marsupial species provides valuable insights into evolutionary biology and mitochondrial function:

Evolutionary Rate and Conservation:

• Mitochondrial genes like MT-ATP6 evolve at different rates compared to nuclear genes

• Comparison between marsupials and placental mammals reveals selective pressures on mitochondrial function

• Analysis can identify conserved functional domains versus regions under relaxed selection

Phylogenetic Relationships:

• MT-ATP6 sequences can contribute to resolving marsupial phylogeny

• Similar approaches using other mitochondrial genes have successfully clarified relationships between the infraclass Metatheria (marsupials) and Eutheria (placentals)

• Evidence suggests marsupial-specific adaptations in mitochondrial function

Functional Evolution Analysis:

• Marsupials like the North American opossum represent one of the most ancient mammalian lineages and are considered an evolutionary success

• Changes in ATP synthase components reflect metabolic adaptations

• Comparison with specialized marsupials like the marsupial mole (which shows evidence of functional loss in other genes due to adaptation to their specific ecological niche) can reveal evolutionary patterns

The molecular data suggests that marsupials have developed distinct strategies during their evolution, which are reflected in both their immune response capabilities and energetic metabolism adaptations .

How can recombinant MT-ATP6 be used in cross-species comparative studies of mitochondrial function?

Recombinant MT-ATP6 from Didelphis marsupialis virginiana provides a valuable tool for cross-species comparative studies:

Functional Reconstitution Studies:

• Recombinant MT-ATP6 can be incorporated into proteoliposomes or nanodiscs

• The reconstituted systems allow measurement of proton transport activity

• Comparative studies with MT-ATP6 from other species enable structure-function analyses

• Different ATP synthase subunits can be combined to create chimeric complexes for functional mapping

Experimental Approach:

• Purify recombinant MT-ATP6 proteins from different species using standardized protocols

• Reconstitute each protein into artificial membrane systems

• Measure proton conductance using pH-sensitive fluorescent dyes or electrophysiological techniques

• Compare kinetic parameters across species

• Correlate functional differences with sequence variations in transmembrane domains

This approach can reveal how evolutionary adaptations in MT-ATP6 sequences affect proton transport efficiency and ATP synthesis rates, potentially correlating with the metabolic demands of different species.

What are the implications of MT-ATP6 mutations for understanding mitochondrial diseases?

Studies of MT-ATP6 across species, including Didelphis marsupialis virginiana, provide insights into mitochondrial disease mechanisms:

Comparative Mutational Analysis:

• Human MT-ATP6 mutations are associated with several mitochondrial disorders, including NARP (Neuropathy, Ataxia, and Retinitis Pigmentosa) and Leigh syndrome

• Comparing equivalent positions in opossum MT-ATP6 can identify critically conserved residues versus those with greater tolerance for variation

• This approach helps predict the pathogenicity of novel human mutations

Research Applications:

• Creation of mutation panels in recombinant MT-ATP6 proteins

• Functional assessment of proton conductance for each variant

• Correlation of biophysical effects with clinical phenotypes in humans

• Potential for developing therapeutic strategies targeting specific functional defects

The evolutionary distance between marsupials and placental mammals makes opossum MT-ATP6 particularly valuable for identifying universally conserved amino acids that are likely essential for function across all mammals.

What are common challenges in purifying recombinant MT-ATP6 and how can they be addressed?

Purification of recombinant MT-ATP6 presents several challenges due to its hydrophobic nature as a transmembrane protein:

Common Challenges and Solutions:

Purification Protocol Optimization:

• Cell lysis optimization: Mechanical disruption methods (sonication or microfluidizer) typically yield better results than chemical lysis

• Two-step purification: Immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography

• Quality control: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to verify monodispersity

Maintaining the native-like environment throughout purification is critical for preserving the functional integrity of the protein.

How can researchers validate the structure and activity of purified recombinant MT-ATP6?

Validating the structural integrity and functional activity of purified recombinant MT-ATP6 requires multiple complementary approaches:

Structural Validation Methods:

• Circular Dichroism (CD) spectroscopy to assess secondary structure content

• Limited proteolysis to verify proper folding

• Thermal shift assays to determine protein stability

• Western blotting with specific antibodies to confirm identity

Functional Assays:

• Proteoliposome reconstitution followed by proton transport measurements

• Patch-clamp electrophysiology of reconstituted channels

• ATP synthase assembly assays when combined with other subunits

• Binding assays with known interaction partners

Analytical Data Interpretation:

• Compare secondary structure content with predicted transmembrane topology

• Establish temperature-stability relationships for storage optimization

• Validate activity against positive controls when available

• Perform concentration-dependent activity measurements to establish specific activity

When interpreting functional data, it's important to consider that the recombinant protein may lack post-translational modifications present in the native protein, potentially affecting certain aspects of activity or stability.