Recombinant Didelphis marsupialis virginiana Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, please specify any format requirements in your order notes; we will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-235
Protein Length
full length protein
Species
Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana)
Target Names
Target Protein Sequence
MPYPMQLGFQDATSPIMEELMYFHDHTLMIVFLISSLVLYIIILMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEIYNPYLTVKAMGHQWYWSYEFTDYENLMFDS YMIPTKDLSPGQLRLLEVDNRIVLPMELPIRMLISSEDVLHAWTMPSLGLKADAIPGRLN QITLTSSRPGVFYGQCSEICGSNHSFMPIVLEMASLKYFEKWSSMMQSFLSYLYI
Uniprot No.

Target Background

Function
Recombinant Didelphis marsupialis virginiana Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c Oxidase Subunit 2 and what is its function in cellular respiration?

Cytochrome c oxidase subunit 2 (MT-CO2, also labeled as COII, COX2, or COXII) is a critical component of the mitochondrial electron transport chain. The protein plays an essential role in cellular respiration by catalyzing the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is crucial for ATP production .

As part of respiratory chain complex IV, MT-CO2 contains the dinuclear copper A center (CU(A)) that receives electrons from reduced cytochrome c in the intermembrane space. These electrons are then transferred via heme A of subunit 1 to the active site binuclear center formed by heme A3 and copper B, where molecular oxygen is reduced to water .

The protein is encoded by the mitochondrial genome and consists of 227 amino acid residues in humans, with a molecular weight of 25,564.73 Da and a theoretical pI of 4.44 . It contains two transmembrane regions (positions 15-45 and 60-87) and is localized to the mitochondrial inner membrane .

How do Didelphis virginiana and Didelphis marsupialis differ at the genetic level?

Didelphis virginiana and Didelphis marsupialis are morphologically similar opossum species that co-occur sympatrically in Mexico, but they can be distinguished at the genetic level through DNA barcoding techniques .

When analyzing the cytochrome c oxidase subunit I (Cox1) mitochondrial gene sequences, the average Kimura's two-parameter (K2P) genetic distances were:

  • 1.56% within D. virginiana populations

  • 1.65% within D. marsupialis populations

  • 7.8-9.3% between the two species

This significant interspecific genetic divergence allows for reliable species discrimination. When Cox1 sequences are analyzed using the neighbor-joining algorithm with the K2P model of nucleotide substitution, the barcode sequences form distinct non-overlapping clusters on phylogenetic trees .

What protocols are recommended for isolating mitochondrial DNA from Didelphis tissue samples?

For isolating mitochondrial DNA from Didelphis tissue samples, researchers should follow these methodological steps:

  • Collect fresh tissue samples (muscle, liver, or heart are optimal) and store in 95% ethanol or at -80°C

  • Homogenize 25-50 mg of tissue in isolation buffer (10 mM Tris-HCl, 0.25 M sucrose, 1 mM EDTA, pH 7.4)

  • Centrifuge at 1,000g for 10 minutes to remove nuclei and cell debris

  • Collect supernatant and centrifuge at 10,000g for 15 minutes to pellet mitochondria

  • Wash mitochondrial pellet twice with isolation buffer

  • Extract mtDNA using a standard phenol-chloroform method or commercial kit designed for mtDNA isolation

  • Verify mtDNA purity by spectrophotometry (A260/A280 ratio of ~1.8)

  • Confirm mtDNA integrity by gel electrophoresis

When working specifically with opossum samples, tissue preservation is critical as mtDNA can degrade rapidly. Field-collected samples should be processed promptly or preserved appropriately to maintain DNA integrity .

What PCR conditions are optimal for amplifying the MT-CO2 gene from Didelphis species?

For optimal PCR amplification of the MT-CO2 gene from Didelphis species, the following protocol is recommended:

PCR Reaction Mixture (50 μL):

  • 5 μL of 10× PCR buffer

  • 2 μL of 50 mM MgCl₂

  • 1 μL of 10 mM dNTP mix

  • 1 μL of each primer (10 μM)

  • 0.5 μL of high-fidelity DNA polymerase

  • 1-5 μL of template mtDNA (50-100 ng)

  • Nuclease-free water to 50 μL

Recommended Primers:

  • Forward: 5'-ATAGCTTTTCCCACGAATAAATAACATAAGC-3'

  • Reverse: 5'-GTTGTTTGATCCTGTTTCGTGA-3'

Thermal Cycling Conditions:

  • Initial denaturation: 94°C for 3 minutes

  • 35 cycles of:

    • Denaturation: 94°C for 30 seconds

    • Annealing: 55°C for 45 seconds

    • Extension: 72°C for 1 minute

  • Final extension: 72°C for 10 minutes

  • Hold at 4°C

For challenging samples, adding 3% DMSO or using a touchdown PCR approach may improve amplification success. PCR products should be verified on a 1.5% agarose gel, with an expected product size of approximately 700 bp .

How does selection pressure influence the evolution of the MT-CO2 gene in Didelphis species?

The evolution of the MT-CO2 gene in Didelphis species reflects complex selective pressures resulting from its critical role in the electron transport chain. Despite being a highly conserved protein essential for cellular respiration, MT-CO2 shows substantial interpopulation divergence at the nucleotide level in some species, such as the marine copepod Tigriopus californicus (nearly 20% divergence) .

  • The majority of codons under strong purifying selection (ω << 1)

  • Approximately 4% of sites evolving under relaxed selective constraint (ω = 1)

  • Potential sites experiencing positive selection, particularly at interaction interfaces with nuclear-encoded proteins

The theoretical basis for this variation despite functional constraints lies in the co-evolution of mitochondrial and nuclear genomes. Since MT-CO2 interacts extensively with nuclear-encoded subunits of cytochrome c oxidase and cytochrome c, amino acid substitutions in MT-CO2 may be driven by compensatory changes necessary to maintain protein-protein interactions .

Research on Didelphis species should focus on analyzing selection patterns in regions of MT-CO2 that interact with nuclear-encoded proteins, as these are most likely to show adaptive evolution.

What are the optimal expression systems and purification strategies for producing recombinant Didelphis MT-CO2 protein?

Producing functional recombinant MT-CO2 from Didelphis species presents significant challenges due to its hydrophobic transmembrane domains and the requirement for proper folding and cofactor incorporation. The following methodological approach is recommended:

Expression Systems Comparison:

Expression SystemAdvantagesDisadvantagesYield (mg/L)
E. coliLow cost, fast growthPoor membrane protein folding0.5-2
Yeast (P. pastoris)Post-translational modifications, membrane integrationLonger expression time2-5
Insect cellsBetter folding, higher eukaryotic systemComplex media, higher cost3-8
Mammalian cellsNative-like folding and processingHighest cost, lowest yield1-3

Recommended Purification Strategy:

  • Construct Design:

    • Remove N-terminal mitochondrial targeting sequence

    • Add affinity tag (His₆ or Strep-tag II) to C-terminus

    • Consider fusion with soluble partner protein (MBP or SUMO)

  • Expression Optimization:

    • Use Pichia pastoris with AOX1 promoter

    • Culture at 22°C after induction

    • Include 0.5% Triton X-100 or 1% digitonin in lysis buffer

  • Purification Protocol:

    • Membrane solubilization with 1% DDM or LMNG

    • IMAC purification using Ni-NTA resin

    • Size exclusion chromatography in buffer containing 0.05% DDM

    • Consider lipid reconstitution for functional studies

The purified protein should be verified by SDS-PAGE, Western blotting, and mass spectrometry. Activity assays can be performed using spectrophotometric methods to measure electron transfer rates.

What molecular techniques can distinguish between recombinant MT-CO2 from D. virginiana versus D. marsupialis?

Distinguishing between recombinant MT-CO2 proteins from D. virginiana and D. marsupialis requires techniques that can detect the specific amino acid differences between these closely related species. Based on the genetic divergence observed in cytochrome oxidase genes, several methodological approaches can be employed:

Peptide Mass Fingerprinting:

  • Digest purified recombinant proteins with trypsin

  • Analyze resulting peptides by MALDI-TOF mass spectrometry

  • Compare observed peptide masses with theoretical digests of both species

  • Species-specific peptides will show mass differences corresponding to amino acid substitutions

Species-Specific Antibody Development:

  • Identify divergent epitopes between the two species' MT-CO2 sequences

  • Synthesize peptides corresponding to these regions

  • Raise antibodies against species-specific epitopes

  • Develop an ELISA or Western blot protocol that can differentiate between the two proteins

Protein Thermal Stability Analysis:
The two MT-CO2 variants likely have different thermal stability profiles due to amino acid differences. Differential scanning fluorimetry (DSF) can measure protein unfolding in response to temperature increases, potentially revealing distinct melting temperature (Tm) values for each species' protein .

How can researchers analyze the structural and functional consequences of MT-CO2 sequence variations between Didelphis species?

To analyze the structural and functional consequences of MT-CO2 sequence variations between Didelphis species, researchers should employ a multi-faceted approach:

1. Structural Analysis Methodology:

  • Homology modeling based on high-resolution crystal structures of mammalian cytochrome c oxidase

  • Molecular dynamics simulations to assess stability differences

  • Analysis of conservation patterns at protein-protein interfaces

  • Mapping amino acid substitutions onto 3D structure to identify functional domains affected

2. Functional Characterization:

  • Electron transfer kinetics measured by stopped-flow spectroscopy

  • Oxygen consumption rates measured by polarography

  • Spectral analysis of heme and copper centers

  • Proton pumping efficiency in reconstituted proteoliposomes

3. Interaction Analysis:

  • Surface plasmon resonance (SPR) to measure binding affinities with cytochrome c

  • Isothermal titration calorimetry (ITC) for thermodynamic parameters of interactions

  • Co-immunoprecipitation with other subunits of the cytochrome c oxidase complex

  • Crosslinking mass spectrometry to identify interaction interfaces

Research Findings Table: Predicted Functional Effects of Species-Specific Variations

RegionAmino Acid DifferencesPredicted Structural EffectPotential Functional Consequence
Cu(A) binding siteConservative substitutionsMinimal structural changesSlight alterations in redox potential
Cytochrome c docking siteMultiple substitutionsAltered surface electrostaticsModified binding kinetics with cytochrome c
Transmembrane helicesHydrophobicity differencesChanges in membrane positioningAltered proton translocation efficiency
Subunit interfacesSpecies-specific residuesModified intersubunit contactsImpact on complex assembly and stability

These methodologies allow researchers to systematically evaluate how sequence variations translate to functional differences between the MT-CO2 proteins of the two Didelphis species .

What are the key considerations when designing experiments to study MT-CO2 evolution across Didelphis populations?

When designing experiments to study MT-CO2 evolution across Didelphis populations, researchers should consider the following methodological factors:

Sampling Strategy:

  • Collection from multiple geographic regions (minimum 5-7 populations)

  • 10-15 individuals per population for statistical power

  • Standardized tissue sampling protocol (prefer fresh liver or muscle tissue)

  • Proper documentation of morphological characteristics for each specimen

  • GPS coordinates and habitat data for each collection site

Sequencing Approach:

  • Complete MT-CO2 gene sequencing rather than partial sequences

  • Bidirectional Sanger sequencing with high-quality coverage

  • Consider whole mitochondrial genome sequencing when resources permit

  • Include flanking regions to capture regulatory elements

Control Measures:

  • Include reference sequences from verified museum specimens

  • Sequence nuclear genes to control for introgression or hybridization

  • Implement rigorous contamination controls during DNA extraction

  • Perform repeat sequencing on a subset of samples to verify results

Analytical Framework:

  • Population genetic analyses (FST, AMOVA)

  • Tests for selection (dN/dS ratio analysis, McDonald-Kreitman test)

  • Phylogeographic analysis with dating of divergence events

  • Correlation with ecological variables and geographic features

This experimental design allows for robust analysis of how MT-CO2 has evolved across different opossum populations and can reveal patterns of selection, genetic drift, and adaptation to local environments .

How can researchers overcome challenges in expressing functional recombinant MT-CO2 with proper cofactor incorporation?

Expressing functional recombinant MT-CO2 with proper cofactor incorporation presents several challenges due to its membrane-associated nature and requirement for copper centers. The following methodological approaches can help overcome these challenges:

1. Copper Incorporation Strategies:

  • Supplement expression media with 50-100 μM CuSO₄

  • Co-express copper chaperones (e.g., Sco1, Cox17)

  • Include copper chelators that facilitate controlled copper delivery

  • Use pulse-chase copper addition during the induction phase

2. Membrane Integration Approaches:

  • Utilize insect cell microsomes for in vitro translation

  • Develop cell-free expression systems with artificial membranes

  • Consider fusion with membrane scaffold proteins

  • Implement detergent screening to identify optimal solubilization conditions

3. Post-purification Reconstitution:

  • Systematic protocol for copper reconstitution after initial purification

  • Controlled redox conditions during purification (maintain reducing environment)

  • Incorporation into nanodiscs or liposomes for functional studies

  • In vitro assembly with other cytochrome oxidase subunits

Troubleshooting Guide for Common Issues:

ProblemPossible CausesSolutions
Low expression yieldProtein toxicity, codon biasUse inducible system, codon optimization
Improper foldingRapid expression, lack of chaperonesLower induction temperature, co-express chaperones
Inactive proteinImproper copper incorporationOptimize copper supplementation, verify copper content
AggregationHydrophobic interactionsScreen detergents, add stabilizing agents
Proteolytic degradationExposure of cleavage sitesInclude protease inhibitors, optimize purification speed

This methodological framework provides researchers with strategies to produce functional recombinant MT-CO2 suitable for structural and functional studies .

What are the best approaches for analyzing the interaction between MT-CO2 and nuclear-encoded components in hybrid systems?

The interaction between mitochondrial-encoded MT-CO2 and nuclear-encoded components represents a critical aspect of mitonuclear compatibility. When analyzing these interactions in hybrid systems (e.g., combining mitochondrial and nuclear components from different Didelphis species), researchers should employ these methodological approaches:

1. Cybrid Cell Line Development:

  • Enucleate cells containing donor mitochondria

  • Fuse with nuclear donor cells lacking mitochondrial DNA

  • Select and validate resulting cybrid cells

  • Measure respiratory function using:

    • Oxygen consumption rate (OCR)

    • Extracellular acidification rate (ECAR)

    • Mitochondrial membrane potential

    • ATP production capacity

2. Protein-Protein Interaction Analysis:

  • Pull-down assays with tagged nuclear subunits

  • Blue native PAGE to assess complex assembly

  • Chemical crosslinking followed by mass spectrometry

  • FRET or BiFC assays for direct visualization of interactions

3. Functional Compatibility Assessment:

  • Measure cytochrome c oxidase activity in isolated mitochondria

  • Assess electron transfer efficiency using spectroscopic methods

  • Evaluate ROS production in matched versus mismatched systems

  • Monitor growth rates and stress responses in cybrid cell lines

Data Analysis Framework:

ParameterCompatible CombinationsIncompatible CombinationsAnalytical Method
Complex IV Activity>80% of control<50% of controlSpectrophotometric assay
ROS ProductionBaseline levels2-5× elevationDCFDA fluorescence
Assembly EfficiencyComplete assembliesPartial/absent assembliesBlue native PAGE
Binding AffinityKd similar to control>5× increase in KdSurface plasmon resonance
ATP Production>75% of control<40% of controlLuciferase-based assay

This comprehensive approach allows researchers to detect incompatibilities between MT-CO2 and nuclear-encoded components from different species or populations, providing insights into the molecular basis of mitonuclear co-adaptation .

How can researchers use molecular modeling to predict functional differences between D. virginiana and D. marsupialis MT-CO2?

Molecular modeling provides powerful tools for predicting functional differences between MT-CO2 proteins from D. virginiana and D. marsupialis without requiring extensive experimental validation. The following methodological approach is recommended:

1. Sequence Analysis and Structure Prediction:

  • Perform multiple sequence alignment of MT-CO2 from both species

  • Identify variable regions and conserved functional domains

  • Generate homology models based on high-resolution mammalian cytochrome c oxidase structures

  • Validate models using tools like PROCHECK, ERRAT, and Verify3D

2. Molecular Dynamics (MD) Simulations:

  • Embed protein models in a simulated membrane environment

  • Perform equilibration and production MD runs (minimum 100 ns)

  • Analyze:

    • RMSD and RMSF for conformational stability

    • Hydrogen bond networks and salt bridges

    • Water/proton channels

    • Dynamics of key functional regions

3. Electrostatic Surface Analysis:

  • Calculate electrostatic potential maps using adaptive Poisson-Boltzmann solver

  • Compare surface properties at cytochrome c binding interface

  • Analyze changes in charge distribution that might affect electron transfer

4. Binding Site Analysis:

  • Identify changes in copper coordination sites

  • Perform molecular docking of cytochrome c to both models

  • Calculate binding energy differences and identify key interaction residues

  • Predict effect of species-specific mutations on binding affinity

5. Electron Transfer Pathway Prediction:

This computational approach generates testable hypotheses about functional differences between the MT-CO2 proteins from the two Didelphis species, guiding subsequent experimental work .

What mass spectrometry techniques are most effective for characterizing post-translational modifications in recombinant MT-CO2?

Characterizing post-translational modifications (PTMs) in recombinant MT-CO2 requires sophisticated mass spectrometry approaches. The following methodological framework is recommended:

1. Sample Preparation Strategies:

  • Multiple proteolytic digestions (trypsin, chymotrypsin, Glu-C)

  • Enrichment of modified peptides (IMAC for phosphopeptides, lectin affinity for glycopeptides)

  • Chemical derivatization to stabilize labile modifications

  • Fractionation to reduce sample complexity (SCX, HILIC)

2. MS Instrumentation and Methods:

  • High-resolution instruments (Orbitrap or QTOF)

  • Multiple fragmentation techniques:

    • HCD for general PTM analysis

    • ETD/ECD for preserving labile modifications

    • UVPD for improved sequence coverage of hydrophobic regions

  • Data-dependent and data-independent acquisition modes

3. Targeted Analysis for Key Modifications:

Modification TypeEnrichment MethodDetection ApproachMass Shift (Da)
PhosphorylationTiO₂ or IMACNeutral loss scanning+79.97
Oxidation (Met, Cys)None requiredPrecursor ion scanning+15.99
Metal coordinationMetal affinityMulti-element detectionVariable
AcetylationAntibody enrichmentImmonium ion detection+42.01
Formylation (N-terminus)None requiredDiagnostic fragments+27.99

4. Data Analysis Workflow:

  • Database searching with variable modifications

  • De novo sequencing for unexpected modifications

  • Manual validation of PTM-containing spectra

  • Site localization scoring (e.g., Ascore for phosphorylation)

  • Quantitative analysis of modification stoichiometry

5. Comparative Analysis:

  • Compare modification patterns between recombinant and native proteins

  • Identify species-specific differences in modification profiles

  • Correlate modifications with functional parameters

  • Map modifications to 3D structural models

This comprehensive approach enables detailed characterization of PTMs in recombinant MT-CO2, providing insights into protein regulation and potential functional consequences of species-specific differences in modification patterns .

How can researchers assess the role of MT-CO2 in mitonuclear compatibility between Didelphis species?

Assessing the role of MT-CO2 in mitonuclear compatibility between Didelphis species requires a systematic approach combining genetic, biochemical, and physiological analyses. The following methodological framework is recommended:

1. Genetic Admixture Analysis:

  • Sequence MT-CO2 and interacting nuclear genes from populations with hybridization zones

  • Analyze linkage disequilibrium patterns between mitochondrial and nuclear variants

  • Test for cytonuclear disequilibrium in hybrid populations

  • Identify signature of selection against incompatible combinations

2. Biochemical Compatibility Testing:

  • Develop in vitro reconstitution system with purified components

  • Measure enzyme kinetics with matched vs. mismatched combinations

  • Analyze protein-protein interaction strength using:

    • Microscale thermophoresis

    • Bio-layer interferometry

    • Hydrogen-deuterium exchange mass spectrometry

3. Cybrid Cell Line Experiments:

  • Create cybrid cell lines combining nuclear background from one species with mitochondria from another

  • Assess multiple bioenergetic parameters:

ParameterMethodCompatible PhenotypeIncompatible Phenotype
Respiratory capacityHigh-resolution respirometryNormal OCRReduced OCR (>30%)
ROS productionMitoSOX fluorescenceBaseline levelsElevated (>2-fold)
Mitochondrial membrane potentialTMRE/JC-1 stainingStable potentialDepolarization
ATP synthesisLuciferase assayEfficient couplingReduced ATP/O ratio
mtDNA copy numberqPCRStable maintenanceDecline over passages

4. Fitness Consequences in Model Systems:

  • Compare growth rates in cybrid cell lines

  • Measure response to metabolic stress conditions

  • Assess gene expression changes using RNA-seq

  • Identify compensatory responses to mitonuclear incompatibility

5. Structural Analysis of Incompatibility:

  • Map incompatible residues to interaction interfaces

  • Perform site-directed mutagenesis to test specific residue contributions

  • Use molecular dynamics to simulate structural consequences of mismatches

  • Identify potential mechanisms of incompatibility (steric clash, charge repulsion, etc.)

This integrated approach can pinpoint the specific role of MT-CO2 in maintaining mitonuclear compatibility between Didelphis species and identify the molecular mechanisms underlying potential reproductive isolation barriers .

How can studies of Didelphis MT-CO2 inform our understanding of mitochondrial evolution and speciation mechanisms?

Studies of MT-CO2 in Didelphis species provide valuable insights into mitochondrial evolution and speciation mechanisms. This research has broad implications for evolutionary biology through the following methodological framework:

1. Molecular Clock Analysis:

  • Calibrate substitution rates in MT-CO2 across Didelphis lineages

  • Compare with other marsupial and mammalian lineages

  • Test for rate heterogeneity across different functional domains

  • Correlate evolutionary rates with ecological and life history traits

2. Selection Pressure Analysis:

  • Calculate dN/dS ratios across the gene and specific functional domains

  • Identify sites under positive, negative, or relaxed selection

  • Compare selection patterns between species and populations

  • Test for episodic selection during speciation events

3. Mitonuclear Co-evolution:

  • Analyze co-evolutionary patterns between MT-CO2 and nuclear-encoded partners

  • Identify compensatory mutations maintaining functional interactions

  • Test for accelerated co-evolution during speciation events

  • Develop a model for mitonuclear incompatibility as a speciation driver

Research Implications Table:

Evolutionary ConceptEvidence from MT-CO2 StudiesBroader Implications
Neutral theoryPattern of synonymous substitutionsCalibration of molecular clocks
Adaptive evolutionPositive selection at interaction sitesRole of selection in mitochondrial evolution
Mitonuclear incompatibilityFunctional differences in hybridsContribution to reproductive isolation
Allopatric speciationGeographic patterns of MT-CO2 variationRole of geographic isolation in divergence
PhylogeographyPopulation structure based on MT-CO2Historical biogeography of Didelphis

4. Speciation Mechanism Insights:

  • Test whether mitonuclear incompatibilities contribute to reproductive isolation

  • Analyze the time course of MT-CO2 divergence relative to speciation events

  • Assess whether MT-CO2 evolution rates correlate with speciation rates

  • Evaluate the role of climatic/geographic factors in driving MT-CO2 adaptation

These approaches allow researchers to use MT-CO2 as a model system for understanding broader evolutionary processes, including the role of mitochondrial genes in speciation and adaptation to new environments .

What are the implications of MT-CO2 functional studies for understanding metabolic adaptations in marsupials?

MT-CO2 functional studies provide valuable insights into metabolic adaptations in marsupials. The following methodological framework enables researchers to connect molecular function to ecological and physiological adaptations:

1. Comparative Enzyme Kinetics:

  • Measure oxygen consumption rates across marsupial species

  • Determine Km and Vmax values for purified cytochrome c oxidase

  • Compare electron transfer efficiency under varying temperature conditions

  • Assess pH dependence of enzyme activity relative to placental mammals

2. Metabolic Adaptation Analysis:

  • Correlate MT-CO2 sequence variations with:

    • Basal metabolic rate

    • Thermal tolerance

    • Hypoxia resistance

    • Hibernation/torpor capacity

  • Test for convergent evolution in species with similar metabolic demands

3. Structure-Function Relationship:

  • Identify adaptive mutations in MT-CO2 across marsupial lineages

  • Map these mutations to functional domains (electron transfer, proton pumping)

  • Perform site-directed mutagenesis to test effects on enzyme function

  • Develop structural models to explain adaptive changes

Comparative Data Table: MT-CO2 Function Across Marsupial Species

SpeciesHabitatMT-CO2 Distinctive FeaturesFunctional ConsequencesMetabolic Adaptation
D. virginianaTemperateHigher thermal stabilityMaintained function at variable temperaturesBroader temperature tolerance
D. marsupialisTropicalModified cytochrome c binding siteAltered electron transfer kineticsOptimized for consistent temperature
Other marsupialsVariousSpecies-specific adaptationsDiverse functional propertiesHabitat-specific metabolic adaptations

4. Ecological Context Integration:

  • Correlate MT-CO2 functional properties with:

    • Geographic distribution

    • Habitat preferences

    • Diet specialization

    • Activity patterns

  • Test whether functional differences reflect ecological adaptations

5. Comparative Physiology:

  • Measure tissue-specific respiratory capacity in different marsupial species

  • Assess mitochondrial density and enzyme activity in key tissues

  • Correlate MT-CO2 functional properties with whole-organism oxygen consumption

  • Develop models linking molecular function to organismal physiology

This comprehensive approach connects molecular-level changes in MT-CO2 to broader metabolic adaptations, providing insights into how marsupials have adapted to diverse ecological niches through modifications of their respiratory chain components .

How can recombinant MT-CO2 be used as a tool for studying mitochondrial disorders and developing potential therapeutics?

Recombinant MT-CO2 from Didelphis species can serve as a valuable tool for studying mitochondrial disorders and developing potential therapeutics. The following methodological framework outlines approaches for translational applications:

1. Model System Development:

  • Express wild-type and mutant variants corresponding to human disease mutations

  • Create chimeric proteins combining domains from different species

  • Develop assays for rapid functional screening

  • Establish reconstituted systems for studying isolated effects

2. Disease Mechanism Investigation:

  • Compare structural and functional properties of wild-type and disease-associated variants

  • Identify molecular mechanisms of dysfunction (assembly defects, electron transfer impairment)

  • Map mutation effects to specific functional domains

  • Use marsupial MT-CO2 as an evolutionary outgroup for understanding conserved disease mechanisms

3. Drug Screening Platform:

  • Develop high-throughput assays using recombinant MT-CO2:

    • Activity-based screens measuring electron transfer

    • Binding assays for assembly factors

    • Thermal stability assays for detecting stabilizing compounds

    • ROS production measurements

4. Therapeutic Strategy Development:

Therapeutic ApproachMethodologyPotential ApplicationsAdvantages of Didelphis Model
Small molecule screeningActivity restoration assaysElectron transfer enhancersEvolutionary perspective on conserved sites
Protein stabilizersThermal shift assaysPreventing degradation of mutant formsTesting across evolutionary distant forms
Assembly modulatorsBlue native PAGE analysisImproving complex formationIdentifying universal assembly mechanisms
Gene therapy constructsComplementation assaysExpression of functional variantsTesting optimized sequences

5. Translational Research Applications:

  • Design peptides mimicking functional domains for therapeutic intervention

  • Develop allotopic expression strategies based on sequence optimization insights

  • Create cell-penetrating constructs delivering functional MT-CO2 to mitochondria

  • Use evolutionary insights to predict mutation pathogenicity in clinical variants

6. Precision Medicine Approaches:

  • Generate patient-specific variants for personalized drug screening

  • Develop biomarkers based on MT-CO2 function or assembly

  • Create predictive algorithms for mutation effects based on evolutionary conservation

  • Identify genetic modifiers that could inform therapeutic strategies

This translational framework leverages the unique properties of Didelphis MT-CO2 to develop tools and approaches for understanding and potentially treating mitochondrial disorders affecting cytochrome c oxidase function .

What are the future research directions for recombinant Didelphis MT-CO2 studies?

Future research on recombinant Didelphis MT-CO2 should address several key knowledge gaps and leverage emerging technologies. The following methodological directions represent promising avenues for advancing the field:

1. Advanced Structural Biology Approaches:

  • Cryo-EM structures of complete cytochrome c oxidase complex with Didelphis MT-CO2

  • Time-resolved structural studies capturing conformational changes during catalysis

  • Hydrogen-deuterium exchange mass spectrometry for dynamics analysis

  • Advanced computational modeling integrating experimental constraints

2. Systems Biology Integration:

  • Multi-omics approaches linking MT-CO2 variations to broader metabolic networks

  • Mathematical modeling of respiratory chain function with species-specific parameters

  • Population-level modeling of mitonuclear co-evolution

  • Integration of ecological and molecular data in predictive frameworks

3. Emerging Technology Applications:

  • Single-molecule studies of electron transfer in reconstituted systems

  • Nanoscale respirometry using novel biosensor approaches

  • CRISPR-based mitochondrial genome editing to test MT-CO2 variants

  • Advanced imaging techniques for visualizing MT-CO2 dynamics in living cells

4. Interdisciplinary Research Opportunities:

Research DirectionMethodological ApproachExpected OutcomesInterdisciplinary Connections
Climate adaptationField studies combined with functional assaysPrediction of metabolic adaptation to climate changeEcology, climate science, molecular evolution
Conservation genomicsPopulation genetics of MT-CO2 in threatened populationsGenetic management recommendationsConservation biology, population genetics
Comparative metabolomicsCorrelation of MT-CO2 variants with metabolite profilesIdentification of metabolic signaturesBiochemistry, systems biology
Ancient DNA analysisRecovery and analysis of MT-CO2 from extinct relativesEvolutionary trajectory reconstructionPaleontology, evolutionary biology

5. Technological Development Needs:

  • Improved expression systems for membrane proteins

  • More sensitive assays for electron transfer kinetics

  • Better computational models for predicting protein-protein interactions

  • Novel approaches for tracking mitochondrial function in vivo

These research directions will advance our understanding of MT-CO2 biology while contributing to broader fields including evolutionary biology, mitochondrial medicine, and ecological physiology .

What are the key methodological challenges that remain in studying recombinant MT-CO2 from Didelphis species?

Despite significant advances, several methodological challenges persist in studying recombinant MT-CO2 from Didelphis species. Addressing these challenges requires innovative approaches and technological developments:

1. Protein Expression and Purification Challenges:

  • Consistent expression of correctly folded membrane protein

  • Incorporation of copper centers with proper stoichiometry

  • Maintaining stability during purification and analysis

  • Achieving sufficient yields for structural studies

Methodological Solutions:

  • Development of specialized expression systems for mitochondrial membrane proteins

  • Optimized protocols for metal incorporation during recombinant expression

  • Novel detergent and nanodisk systems for improved stability

  • High-throughput screening of expression and purification conditions

2. Functional Analysis Limitations:

  • Difficulty in reconstituting complete electron transport chain

  • Challenges in measuring transient electron transfer events

  • Limited methods for assessing proton pumping activity

  • Complexity of separating MT-CO2 function from other subunits

Technical Advancement Needs:

  • Improved time-resolved spectroscopic methods

  • Development of sensitive proton flux assays

  • Advanced reconstitution systems mimicking mitochondrial inner membrane

  • Novel approaches for subunit-specific functional analysis

3. Comparative Analysis Challenges:

ChallengeCurrent LimitationsMethodological Solutions
Limited reference dataFew marsupial MT-CO2 sequences availableExpanded sequencing of diverse marsupial species
Functional validationDifficulty validating in silico predictionsDevelopment of medium-throughput functional assays
Physiological relevanceGap between in vitro and in vivo observationsImproved cellular and organismal models
Ecological contextLimited integration of field and lab dataCollaborative research combining field and molecular approaches

4. Translation to Applied Research:

  • Difficulty in establishing disease relevance of species-specific variants

  • Challenges in developing therapeutically relevant insights

  • Limited tools for manipulating mitochondrial genes in vivo

  • Complexity of mitonuclear interactions in heterologous systems

5. Data Integration Challenges:

  • Difficulty in connecting molecular data to ecological observations

  • Limited computational models for predicting complex phenotypes

  • Challenges in interpreting selection signatures across timescales

  • Need for improved statistical approaches for small sample sizes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.