Recombinant Didelphis marsupialis virginiana Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant Didelphis marsupialis virginiana (North American opossum) PTH1R is a 559-amino acid protein (27–585aa) fused to an N-terminal His tag, expressed in E. coli . Key structural features include:

ParameterSpecification
UniProt IDP25107
Molecular Weight~65 kDa (calculated)
SequenceIncludes conserved domains for G-protein coupling and ligand binding
Post-Translational SitesPredicted N-glycosylation sites at Asn-203 and Asn-367 (absent in bacterial expression)
Purity>90% via SDS-PAGE

The protein's α-helical structure enables engagement with transmembrane (TM) regions (TMs 1/2/3/5/6/7) and extracellular loops (ECLs 2/3) .

Functional Insights

PTH1R is a Class B G-protein-coupled receptor (GPCR) critical for calcium homeostasis and bone metabolism. Key findings include:

  • Signaling Pathways: Activates cAMP, Gαq/calcium influx, and β-arrestin pathways .

  • RAMP Modulation: Interaction with Receptor Activity-Modifying Proteins (RAMP2/3) enhances cell surface expression by 30–50% and modifies signaling duration .

  • Ligand Specificity: Binds PTH and PTH-related peptides (e.g., LA-PTH, ABL) with distinct conformational dynamics .

Expression Systems

  • Host: E. coli (default), mammalian cells, or cell-free systems .

  • Yield: 0.1–1.0 mg/mL after reconstitution in Tris/PBS buffer (6% trehalose, pH 8.0) .

  • Storage: Lyophilized powder stable at -80°C; working aliquots retain activity for 1 week at 4°C .

Research Applications

ApplicationUtility
Structural StudiesFRET imaging of RAMP-PTH1R interactions
Disease ModelingStudy of Blomstrand chondrodysplasia, Jansen metaphyseal chondrodysplasia
Drug ScreeningEvaluation of PTH analogs (e.g., LA-PTH) for osteoporosis therapy

Clinical Relevance

  • Genetic Disorders: Over 60 PTH1R variants are linked to primary failure of tooth eruption (PFE), characterized by truncated receptors lacking G-protein binding domains (e.g., c.1325-1336del) .

  • Skeletal Development: Conditional knockout mice (Prx1cre;PTH1R fl/fl) exhibit limb shortening and growth retardation due to impaired FGF23 regulation .

Comparative Analysis

Urban vs. rural Didelphis populations show habitat-dependent variability in hematological parameters (e.g., urban opossums have ↑WBC counts), though PTH1R biochemistry remains stable across environments .

Future Directions

  • Develop thermostable mutants for prolonged in vitro assays.

  • Investigate RAMP2/3 co-expression effects on PTH1R-mediated osteoclastogenesis.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
PTH1R; PTHR; PTHR1; Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor; PTH/PTHr receptor; Parathyroid hormone 1 receptor; PTH1 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-585
Protein Length
Full Length of Mature Protein
Species
Didelphis virginiana (North American opossum) (Didelphis marsupialis virginiana)
Target Names
Target Protein Sequence
DADDVITKEEQIILLRNAQAQCEQRLKEVLRVPELAESAKDWMSRSAKTKKEKPAEKLYS QAEESREVSDRSRLQDGFCLPEWDNIVCWPAGVPGKVVAVPCPDYIYDFNHKGRAYRRCD SNGSWELVPGNNRTWANYSECVKFLTNETREREVFDRLGMIYTVGYSISLGSLTVAVLIL GYFRRLHCTRNYIHMHLFVSFMLRAVSIFIKDAVLYSGVSTDEIERITEEELRAFTEPPP ADKAGFVGCRVAVTVFLYFLTTNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTLFGWGLP AVFVAVWVTVRATLANTECWDLSSGNKKWIIQVPILAAIVVNFILFINIIRVLATKLRET NAGRCDTRQQYRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGILWQVQMHYEMLFNSFQG FFVAIIYCFCNGEVQAEIKKSWSRWTLALDFKRKARSGSSTYSYGPMVSHTSVTNVGPRG GLALSLSPRLAPGAGASANGHHQLPGYVKHGSISENSLPSSGPEPGTKDDGYLNGSGLYE PMVGEQPPPLLEEERETVM
Uniprot No.

Target Background

Function
This receptor serves as a binding site for both parathyroid hormone (PTH) and parathyroid hormone-related peptide (PTHrP). Its activity is mediated by G proteins, which activate both adenylyl cyclase and a phosphatidylinositol-calcium second messenger system.
Protein Families
G-protein coupled receptor 2 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How does the ligand binding mechanism of marsupial PTH1R compare with human PTH1R, and what experimental approaches can elucidate these differences?

The binding mechanism of ligands to PTH1R follows a two-site model across species. For comparative analysis between marsupial and human PTH1R:

Recommended experimental design:

  • Competitive binding assays using labeled and unlabeled ligands (PTH and PTHrP)

  • Site-directed mutagenesis of key residues in both site 1 (extracellular domain) and site 2 (transmembrane domain) regions

  • X-ray crystallography or cryo-EM analysis of receptor-ligand complexes

Based on human PTH1R studies, researchers should focus on:

  • The C-terminal portion of ligands (residues 15-34) interacting with the amino-terminal extracellular domain (site 1)

  • The N-terminal portion of ligands (residues 1-14) interacting with the transmembrane helices and connecting loops (site 2)

Previous structural characterization of human PTH1R shows a helix-into-cleft motif for site 1 interactions, with the α-helical ligand domain making extensive contacts with the receptor extracellular domain . Comparative analyses should determine if these interaction patterns are conserved in the marsupial receptor.

  • What methodologies can be employed to distinguish between different conformational states of marsupial PTH1R, particularly the R₀ versus RG states?

To investigate the conformational dynamics of marsupial PTH1R:

Membrane binding assay protocol:

  • Prepare cell membranes expressing recombinant marsupial PTH1R

  • Conduct binding assays under conditions that favor either:

    • RG conformation (G-protein coupled state): Include GTPγS in the binding buffer

    • R₀ conformation (G-protein uncoupled state): Omit G-proteins or include GDP

Analysis parameters:

  • Compare binding affinities (Kd values) of PTH and PTHrP analogues to each conformational state

  • Investigate whether structural differences between PTH and PTHrP (particularly at position 5, where PTH has Ile and PTHrP has His) affect conformational selectivity

Conformational StateRecommended Ligands for ProbingExpected Pattern
R₀ (uncoupled)Modified PTH (M-PTH) analoguesHigher affinity, prolonged signaling
RG (G-protein coupled)PTH(1-34) and PTHrP(1-36)Similar affinity for both ligands

This experimental approach will reveal whether marsupial PTH1R exhibits conformational selectivity similar to human PTH1R, where some ligands show differential affinity for R₀ versus RG states .

  • How can researchers assess pathway-selective signaling (biased agonism) in marsupial PTH1R, and what experimental controls are essential?

To investigate biased signaling through marsupial PTH1R:

Comprehensive signaling assessment protocol:

  • Measure activation across multiple pathways in parallel:

    • Gαs–adenylyl cyclase–cAMP–PKA pathway: Use FRET-based cAMP sensors or direct cAMP immunoassays

    • Gαq–PLCβ–IP₃–Ca²⁺–PKC pathway: Measure intracellular calcium flux or IP₃ production

    • Gα12/13–phospholipase D–RhoA pathway: Assess RhoA activation via pull-down assays

    • β-arrestin–ERK1/2 pathway: Measure β-arrestin recruitment and ERK1/2 phosphorylation

  • Test structurally diverse PTH/PTHrP analogues with systematic modifications, particularly:

    • Position 5 variants (Ile vs His)

    • Modified PTH (M-PTH) analogues known to exhibit distinct signaling properties

Essential controls:

  • Include both PTH(1-34) and PTHrP(1-36) as reference ligands

  • Use cell types that express NHERF family proteins, which selectively promote receptor coupling to the Gαq–PLCβ pathway

  • Include pathway-specific inhibitors to confirm signal specificity

Bias quantification:

  • Calculate bias factors using operational models to quantitatively compare pathway activation profiles between ligands and across species

This approach will determine whether the marsupial receptor exhibits signaling bias patterns similar to or distinct from the human receptor.

  • What methodological approaches can be used to evaluate the duration of cAMP signaling responses induced by different ligands binding to marsupial PTH1R?

To assess temporal signaling profiles of marsupial PTH1R:

Kinetic FRET-based cAMP monitoring protocol:

  • Express marsupial PTH1R in appropriate cells (HEK-293 or osteoblast-like cells)

  • Co-express FRET-based cAMP biosensors (e.g., EPAC-based sensors)

  • Establish baseline FRET signal

  • Add ligand and monitor initial response

  • Perform washout to remove unbound ligand

  • Continue monitoring FRET signal over extended time (minutes to hours)

Comparative assay design:

  • Test PTH(1-34) versus PTHrP(1-36) to assess differences in signaling duration

  • Include modified PTH analogues with enhanced R₀ affinity, which may induce ultra-prolonged responses

  • Analyze marsupial-specific ligands if available

Complementary approaches:

  • Direct measurement of cAMP accumulation in cells expressing low levels of receptor (~90,000 receptor molecules per cell) at various timepoints after ligand washout

  • Membrane binding assays to correlate signaling duration with ligand dissociation kinetics

These methods will determine whether different ligands exhibit distinct temporal signaling profiles through marsupial PTH1R, similar to the pattern observed with human PTH1R where PTH(1-34) induces more prolonged signaling than PTHrP(1-36) .

  • How can evolutionary conservation analysis of PTH1R be systematically conducted to understand functional adaptation across species?

For comparative evolutionary analysis of PTH1R:

Sequence analysis methodology:

Functional validation:

  • Design chimeric receptors swapping domains between marsupial and human PTH1R

  • Assess ligand binding and signaling properties of chimeric receptors

  • Correlate functional differences with sequence divergence

This approach will reveal evolutionary adaptations in PTH1R structure that may relate to species-specific differences in calcium and phosphate homeostasis regulation.

  • What are the optimal experimental design considerations for assessing the binding affinity and specificity of ligands to recombinant marsupial PTH1R?

For rigorous binding affinity assessment:

Comprehensive binding analysis protocol:

  • Radioligand binding assays:

    • Direct binding with ¹²⁵I-labeled PTH or PTHrP analogues

    • Competition binding with unlabeled ligands

    • Analysis of saturation binding curves to determine Bmax and Kd values

  • Surface plasmon resonance (SPR) methodology:

    • Immobilize purified receptor on sensor chip

    • Flow ligands at various concentrations

    • Analyze association and dissociation kinetics (kon and koff)

    • Calculate equilibrium dissociation constants (KD = koff/kon)

  • Fluorescence-based assays:

    • Label ligands with appropriate fluorophores

    • Measure binding by fluorescence polarization or FRET

    • Determine affinity constants from equilibrium measurements

Critical controls:

  • Include positive controls (human PTH1R) for comparison

  • Use known ligands (PTH 1-34, PTHrP 1-36) at established concentrations

  • Include negative controls (unrelated GPCRs) to confirm specificity

  • Verify receptor density and functionality before binding experiments

Data analysis:

  • Apply appropriate binding models (one-site, two-site, cooperative)

  • Use global fitting for complex binding mechanisms

  • Calculate confidence intervals for all derived parameters

This systematic approach will generate reliable binding data for marsupial PTH1R that can be compared with human receptor data.

  • How can researchers establish and validate cell-based functional assays for investigating marsupial PTH1R signaling in different cellular contexts?

To develop robust cell-based assays for marsupial PTH1R:

Assay development protocol:

  • Cell system selection:

    • Heterologous expression systems (HEK-293, CHO cells) for controlled receptor levels

    • Osteoblast-like cells (ROS17/2.8) for physiologically relevant context

    • Renal tubule cells for mineral transport studies

  • Receptor expression strategy:

    • Stable cell lines (for reproducibility)

    • Inducible expression systems (for controlled expression levels)

    • Viral transduction (for difficult-to-transfect cells)

  • Functional readout selection:

    • Real-time cAMP FRET sensors for temporal resolution

    • Calcium flux assays for Gαq pathway activation

    • Reporter gene assays (CRE-luciferase) for transcriptional responses

    • ERK1/2 phosphorylation for MAPK pathway activation

Validation methodology:

  • Receptor expression verification by Western blot and radioligand binding

  • Dose-response curves with reference ligands

  • Time-course analysis to determine optimal measurement windows

  • Pathway inhibitor controls (PKA inhibitors, PLC inhibitors)

  • Comparison with human PTH1R responses under identical conditions

Signaling PathwayRecommended AssayTemporal Resolution
Gαs-cAMPFRET-based sensorsSeconds to hours
Gαq-calciumFluorescent calcium indicatorsSeconds to minutes
β-arrestinBRET-based recruitment assaysMinutes
ERK1/2Phospho-specific antibodiesMinutes to hours

This comprehensive approach will establish reliable assays for investigating the signaling properties of marsupial PTH1R across multiple pathways and cellular contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.