Recombinant Dinodon semicarinatum ATP synthase subunit a (MT-ATP6)

Shipped with Ice Packs
In Stock

Description

Functional Significance

MT-ATP6 is indispensable for ATP synthase activity, facilitating proton flow across mitochondrial membranes to drive ATP synthesis. Mutations in MT-ATP6 are linked to mitochondrial disorders such as:

  • Leigh syndrome (20% of cases involve MT-ATP6 mutations)

  • NARP syndrome (Neuropathy, Ataxia, Retinitis Pigmentosa)

  • Parkinson’s disease and multiple sclerosis (associated polymorphisms)

Mechanistic Role:

  • Forms the proton-conducting channel with the c-ring subunit .

  • Stabilizes ATP synthase dimers/oligomers, critical for cristae formation .

Pathogenic Variant Analysis

Yeast models of human MT-ATP6 variants revealed pathogenicity-linked mutations (e.g., m.8950G>A, m.9025G>A) that disrupt ATP production and growth under respiratory conditions .

VariantFunctional Defect ObservedPathogenicity Evidence
m.8950G>AImpaired ATP synthesis, growth deficiencyConfirmed pathogenic
m.9025G>AReduced mitochondrial membrane potentialConfirmed pathogenic
m.9029A>GCompromised enzyme assemblyConfirmed pathogenic

Therapeutic Research

  • Recombinant MT-ATP6 aids in studying inhibitor binding (e.g., oligomycin) to the F<sub>O</sub> domain .

  • Used in ELISA assays to quantify ATP synthase dysfunction in mitochondrial disorders .

Pathway Involvement

MT-ATP6 participates in critical metabolic pathways, as outlined below:

PathwayRole of MT-ATP6Associated Proteins
Oxidative PhosphorylationProton gradient-driven ATP synthesisATP5O, NDUFA1, COX7B2
Metabolic PathwaysEnergy metabolism regulationGPT, PCCB, TAT
Neurodegenerative DiseasesATP deficiency in neuronal cellsSDHA, VDAC2, BID

Future Directions

  • Structural Studies: Cryo-EM analysis to resolve proton translocation mechanics .

  • Therapeutic Screens: High-throughput assays targeting MT-ATP6 for mitochondrial disease drug discovery .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-ATP6; ATP6; ATPASE6; MTATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Lycodon semicarinatus (Ryukyu odd-tooth snake) (Eumesodon semicarinatus)
Target Names
Target Protein Sequence
MTMNMFEQFMSPELLMIPTALLSMLVPVLLIHHNPKLLGNRMTTAIAWLLMTIMSNMTNQ LTPSGQKWCQVLTSLLLMILLSNLLGLLPYTFTSTSQLSMNMAMAIPLWMATIITGMTKK PSITLAHMLPEGSPTPLIPFMIIIETISLLMRPLALGVRLTANITAGHLLMTMVSTTTLN FITSHITLSIMTYLLLFLLCILELAVACIQAYVFVLLIILYLQENT
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP utilizing a proton gradient across the membrane. This gradient is generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembranous catalytic core F1 and the membrane proton channel F0, linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. Subunit a is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ATP6 and what is its role in ATP synthase?

MT-ATP6 (mitochondrially encoded ATP synthase membrane subunit 6, also known as subunit a) is a critical component of the F0 domain of ATP synthase (Complex V) located in the inner mitochondrial membrane. It plays a key role in the proton channel, directly participating in the translocation of protons across the membrane . The proton flow through this channel drives the rotary mechanism of ATP synthase, coupling proton movement to ATP synthesis in the F1 domain of the complex .

In mitochondrial ATP synthase, proton translocation through the F0 subcomplex and ATP synthesis/hydrolysis in the F1 subcomplex are coupled by subunit rotation . MT-ATP6 forms part of the proton channel that allows protons to flow down their electrochemical gradient, which powers the rotation of the c-ring and subsequently the central stalk, ultimately driving ATP synthesis .

How does recombinant MT-ATP6 compare to its native form?

Recombinant Dinodon semicarinatum MT-ATP6 differs from the native protein in several significant ways:

FeatureNative MT-ATP6Recombinant MT-ATP6
Expression systemMitochondrial translation machineryE. coli expression system
Protein modificationsNative post-translational modificationsN-terminal His-tag or other affinity tags
Assembly stateIntegrated within complete ATP synthase complexPurified as individual subunit
Storage requirementsWithin mitochondrial membraneSpecial buffer conditions (Tris-based buffer with glycerol or trehalose)
PurityPart of heterogeneous membrane environmentGreater than 90% as determined by SDS-PAGE

The recombinant protein is typically provided as either a lyophilized powder or in a stabilizing buffer with recommendations against repeated freeze-thaw cycles to maintain integrity .

What methods are used to express and purify recombinant Dinodon semicarinatum MT-ATP6?

Based on the available research data, recombinant Dinodon semicarinatum MT-ATP6 is expressed and purified using the following methodology:

Expression System:

  • Bacterial expression in E. coli

  • The full-length protein (amino acids 1-226) is expressed with an N-terminal His-tag for purification purposes

Purification Protocol:

  • Affinity chromatography utilizing the His-tag

  • SDS-PAGE verification of purity (greater than 90%)

  • Buffer exchange into storage buffer

  • Lyophilization or storage in stabilizing buffer

Storage Conditions:

  • Lyophilized powder form

  • Alternative storage in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

  • Recommended storage at -20°C/-80°C

  • Working aliquots may be stored at 4°C for up to one week

Reconstitution Protocol:

  • Brief centrifugation prior to opening

  • Reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of 5-50% glycerol for long-term storage stability

What experimental assays can be used to evaluate MT-ATP6 function?

Several complementary approaches can be used to assess the functionality of MT-ATP6:

ATP Synthesis and Hydrolysis Assays:

  • Measurement of ATP synthesis rates using different substrates (e.g., malate, succinate)

  • ATP hydrolysis capacity testing, which may remain normal even when synthesis is compromised

Membrane Potential Analysis:

  • Fluorescent probe-based measurement of mitochondrial membrane potential

  • This can reveal whether mutations cause increased potential (indicating proton backup) or decreased potential (indicating unregulated proton leak)

Oligomycin Sensitivity Testing:

  • Altered sensitivity to oligomycin (an ATP synthase inhibitor) can indicate functional changes in MT-ATP6

  • Both increased and decreased sensitivity have been observed with different MT-ATP6 variants

Complex Assembly Analysis:

  • Blue Native PAGE (BN-PAGE) to assess ATP synthase complex formation

  • Particularly useful for determining if defects are due to assembly failure or functional impairment

Real-time Metabolic Measurements:

  • Oxygen consumption rate (OCR) and extracellular acidification rate (ECAR) using platforms like Seahorse

  • These measurements help distinguish between respiratory capacity and glycolytic compensation

How does MT-ATP6 contribute to ATP synthase assembly?

MT-ATP6 plays a critical role in the assembly of functional ATP synthase, particularly in the final stages of complex formation:

  • MT-ATP6 is one of the last components to be incorporated during ATP synthase assembly

  • The assembly process involves multiple pathways that converge at a key intermediate stage before accepting the mitochondrially encoded subunits including MT-ATP6

  • Subunit A6L (ATP8) provides a physical link between the proton channel (containing MT-ATP6) and the other subunits of the peripheral stalk

Research indicates that ATP synthase assembly in yeast involves two separate pathways (F1/Atp9p and Atp6p/Atp8p/stator subunits) that converge at the end stage . In human mitochondria, the addition of MT-ATP6 and ATP8 to a key intermediate complex is stabilized by the addition of subunit j, leading to an ATP synthase complex that is coupled to the proton motive force and capable of making ATP .

How can researchers distinguish between different functional defects in MT-ATP6 variants?

Distinguishing between different types of functional defects in MT-ATP6 variants requires a multi-faceted experimental approach:

Differential Biochemical Profiling:
The table below summarizes biochemical anomalies associated with different MT-ATP6 variants, illustrating how distinct mutation patterns can help identify specific functional defects:

MT-ATP6 VariantATP SynthesisATP HydrolysisMembrane PotentialProposed Mechanism
m.8993T>GDecreased (36/38)Normal (19/22)Increased (7/8)Anomalous salt bridge formation between subunits a & c result in no rotation of rotor after proton translocation
m.8993T>CDecreased (8/12) but milder than T>GNormal (6/6)Not specifiedAbnormal structure of proton pore causing partial reduction of ATP synthesis
m.9029A>GNot specifiedNot specifiedIncreased (1/1)Prevent proton translocation
m.9185T>CNormal (1/1)Decreased (3/5)Decreased (3/3)Impairment of proton pump

Methodological Approaches:

  • Combined ATP synthesis and hydrolysis assays: Many MT-ATP6 variants show decreased ATP synthesis but normal ATP hydrolysis, indicating a specific defect in the synthesis direction potentially related to proton translocation

  • Comparative oligomycin sensitivity testing: The m.8993T>G variant shows both decreased (6/8) and increased (5/12) sensitivity to oligomycin in different studies, suggesting complex functional effects that may depend on experimental conditions

  • Baseline versus uncoupled respiration: Measuring both can help determine if the defect is in proton translocation or in the coupling mechanism between proton flow and ATP synthesis

  • ROS generation measurement: Increased ROS production with certain mutations (e.g., m.9025G>A, m.9029A>G) provides additional evidence of proton path disruption

What role does MT-ATP6 play in ATP synthase dimerization and cristae formation?

ATP synthase forms dimers and oligomers in the inner mitochondrial membrane that are critical for proper cristae morphology. While the search results don't directly address the specific role of Dinodon semicarinatum MT-ATP6 in dimerization, research on ATP synthase provides important insights:

  • ATP synthase subunit e (ATP5I) has been identified as playing a key role in stabilizing F1F0-ATP synthase dimers, which are essential for cristae morphology

  • The dimerization of ATP synthase creates a bend in the inner mitochondrial membrane that facilitates cristae formation

  • MT-ATP6, as a component of the F0 domain located in the membrane, likely participates in these inter-complex interactions that shape mitochondrial ultrastructure

  • In Saccharomyces cerevisiae, ATP synthase can be linked through subunits i in the inner mitochondrial membrane, suggesting similar mechanisms may exist for MT-ATP6

  • Mutations in MT-ATP6 can lead to altered mitochondrial morphology, as seen in various mitochondrial diseases

This structural role represents an important dimension of ATP synthase function beyond its enzymatic activity in ATP production, linking energy metabolism with mitochondrial morphology.

What are the major technical challenges in studying recombinant MT-ATP6 and potential solutions?

Studying recombinant MT-ATP6 presents several significant technical challenges:

Challenge 1: Membrane Protein Expression and Purification

  • MT-ATP6 is a hydrophobic membrane protein, making expression and purification challenging

  • Solution: Use of specialized expression systems and detergents; the currently successful approach uses E. coli with appropriate tags

Challenge 2: Maintaining Protein Stability

  • Search results indicate that "repeated freezing and thawing is not recommended"

  • Solution: Storage in specialized buffers with stabilizers like glycerol (5-50%) or trehalose (6%); careful aliquoting to avoid freeze-thaw cycles

Challenge 3: Functional Reconstitution

  • MT-ATP6 functions as part of a large multi-protein complex in a membrane environment

  • Solution: Development of reconstitution systems in liposomes or nanodiscs that mimic the native membrane environment

Challenge 4: Assay Development and Interpretation

  • Different MT-ATP6 variants show inconsistent patterns of biochemical abnormalities

  • Solution: Use of multiple complementary assays as demonstrated in the comprehensive study of MT-ATP6 variants

Challenge 5: Heteroplasmy Considerations

  • When studying disease-associated variants, heteroplasmy levels significantly affect phenotype manifestation

  • Solution: Carefully controlled studies that account for heteroplasmy levels, as in the analysis showing symptomatic subjects had significantly higher heteroplasmy load (p=1.6×10^-39)

How might biguanides and other pharmacological agents interact with MT-ATP6?

Recent research has identified potential interactions between pharmacological agents and ATP synthase components:

  • Biguanide Interactions:

    • Research has identified ATP synthase subunit e (ATP5I) as a key target of medicinal biguanides

    • Biguanides like metformin may affect ATP synthase dimerization

    • ATP5I knockout cells show resistance to biguanide-induced antiproliferative effects, suggesting interaction with the ATP synthase complex

  • Oligomycin as a Research Tool:

    • Oligomycin sensitivity is frequently used to assess MT-ATP6 function

    • Different MT-ATP6 variants show altered sensitivity to oligomycin (both increased and decreased)

    • This differential sensitivity helps distinguish between various functional defects

  • Potential Mechanisms:

    • Biguanides may affect the stability of F1F0-ATP synthase dimers

    • This could alter cristae morphology and mitochondrial function

    • BN-PAGE (Blue Native PAGE) followed by western blot using the β-subunit of the F1 domain could reveal whether metformin affects ATP synthase dimerization

  • Experimental Approaches:

    • Long-term treatments (3-6 days) with high concentrations of metformin (10 mM) may be required to detect subtle yet biologically relevant shifts in monomer and dimer populations

    • Combining metformin treatment with assays that measure ATP synthesis, hydrolysis, and membrane potential can provide a comprehensive view of drug effects on MT-ATP6 function

How do mutations in MT-ATP6 contribute to human diseases?

Mutations in MT-ATP6 are associated with several mitochondrial diseases with diverse clinical presentations:

  • Neuropathy, Ataxia, and Retinitis Pigmentosa (NARP) is associated with MT-ATP6 mutations, particularly m.8993T>G

  • Leigh Syndrome, a severe neurological disorder, can be caused by high heteroplasmy levels of MT-ATP6 mutations

  • MT-ATP6-Related Mitochondrial Spastic Paraplegia is linked to specific mutations in this gene

  • MT-ATP6 has also been implicated in Leber hereditary optic neuropathy, Parkinson's disease, multiple sclerosis, and systemic lupus erythematosus

The clinical manifestation of these disorders depends significantly on heteroplasmy levels (the proportion of mutated mtDNA), with symptomatic patients showing significantly higher heteroplasmy load compared to asymptomatic carriers (p=1.6×10^-39) .

What methodologies are most effective for studying disease-relevant MT-ATP6 variants?

Effective study of disease-relevant MT-ATP6 variants requires a multi-faceted approach:

  • Heteroplasmy Quantification:

    • Accurate measurement of mutant mtDNA percentage is critical as disease manifestation correlates with heteroplasmy level

    • Next-generation sequencing and digital droplet PCR provide precise quantification

  • Biochemical Characterization Matrix:
    Research shows that different MT-ATP6 variants produce distinct biochemical profiles that can guide diagnosis and mechanistic understanding:

    Biochemical TestExample Results for Disease Variants
    ATP synthesisDecreased in 36/38 cases with m.8993T>G, 8/12 with m.8993T>C (milder)
    ATP hydrolysisOften preserved (normal in 19/22 cases with m.8993T>G)
    Membrane potentialTypically increased with m.8993T>G (7/8 cases), decreased with m.9185T>C (3/3)
    Complex assemblyDecreased holocomplex V assembly in 14/18 cases with m.8993T>G
    Oligomycin sensitivityVariable - both increased and decreased sensitivity observed
  • Functional Models:

    • Cybrid cell lines (patient mtDNA in control nuclear background)

    • Recombinant protein systems for specific mechanistic studies

    • Animal models with equivalent mutations

  • Structural Studies:

    • Comparing wild-type and mutant MT-ATP6 structures

    • Molecular dynamics simulations to predict functional impacts

These approaches together provide a comprehensive assessment of how specific mutations affect MT-ATP6 function and contribute to disease pathogenesis.

How might MT-ATP6 research contribute to understanding ATP synthase in Alzheimer's disease?

Recent research has begun exploring connections between ATP synthase dysfunction and Alzheimer's disease (AD):

  • The mitochondrial hypothesis of AD focuses on mitochondrial dysfunction, with emerging evidence suggesting potential roles for ATP synthase components including MT-ATP6

  • ATP synthase is a proton pump that harnesses the chemical potential energy of the proton gradient across the inner mitochondrial membrane to produce ATP, and dysfunction in this process may contribute to energy deficits in AD

  • Research methodologies studying MT-ATP6 variants could be applied to investigate potential ATP synthase dysfunction in AD models

  • Potential research directions include:

    • Examining ATP synthase assembly and stability in AD models

    • Investigating proton translocation efficiency in AD-affected mitochondria

    • Exploring connections between ATP synthase dimerization, cristae morphology, and AD pathology

    • Assessing MT-ATP6 and other ATP synthase component modifications in AD brain tissue

  • Given the critical role of MT-ATP6 in energy production, further research could reveal whether targeting this subunit might offer therapeutic potential for neurodegenerative conditions like AD

What novel approaches could advance the study of MT-ATP6 function and interactions?

Emerging technologies and approaches offer new opportunities for studying MT-ATP6:

  • Cryo-EM Structural Analysis:

    • Recent advances in cryo-electron microscopy enable higher resolution structural studies of membrane proteins

    • This could reveal detailed interactions between MT-ATP6 and other ATP synthase components

    • Potential to visualize conformational changes during the catalytic cycle

  • Advanced Reconstitution Systems:

    • Nanodiscs and other membrane mimetics allow study of membrane proteins in near-native environments

    • These systems could enable detailed biophysical characterization of MT-ATP6 function

  • CRISPR-Based Approaches:

    • Precise genome editing of mtDNA, though technically challenging, could create cellular models with specific MT-ATP6 variants

    • ATP5I knockout studies have already provided insights into ATP synthase function

  • High-Resolution Imaging:

    • Super-resolution microscopy and advanced image analysis (e.g., using Fiji for mitochondrial network quantification)

    • These approaches can link MT-ATP6 function to mitochondrial morphology and dynamics

  • Integrative Omics Approaches:

    • Combining proteomics, metabolomics, and transcriptomics to understand broader impacts of MT-ATP6 variants

    • This could reveal compensatory mechanisms and potential therapeutic targets

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.