Recombinant Dinoroseobacter shibae ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Recombinant Dinoroseobacter shibae ATP synthase subunit a (AtpB) is a 248-amino acid protein (UniProt ID: A8LKI0) produced via heterologous expression in E. coli. It is a key component of the F₀ sector of ATP synthase, responsible for proton channel formation during oxidative phosphorylation . In D. shibae, ATP synthase enables ATP regeneration under oxygen-depleted conditions by coupling proton gradients to ATP synthesis, a process vital for survival in fluctuating marine environments .

Production and Purification

The recombinant AtpB is synthesized in E. coli using codon-optimized sequences. Key steps include:

  1. Induction: IPTG-induced expression in bacterial cultures.

  2. Purification: Affinity chromatography via His-tag, followed by size-exclusion chromatography .

  3. Quality control: Validated by SDS-PAGE and mass spectrometry .

Functional Insights from Research

  • Role in anaerobic respiration: During oxygen depletion, D. shibae upregulates ATP synthase activity to maintain ATP production via nitrate respiration .

  • Structural stability: The protein’s transmembrane helices (residues 20–240) are essential for proton channel integrity .

  • Interactions: Binds to subunit c (AtpE) and subunit b (AtpF) to form the F₀ rotor complex .

Applications in Research

  • Enzyme kinetics: Used to study proton-driven ATP synthesis mechanisms .

  • Structural biology: Serves as a template for cryo-EM studies of ATP synthase complexes .

  • Antibody production: Immunogen for generating subunit-specific antibodies .

Limitations and Future Directions

  • Thermal instability: Requires stringent temperature control during handling .

  • Research gaps: Structural dynamics during proton translocation remain unresolved . Future studies could leverage cryo-ET to visualize conformational changes in situ.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference during order placement. We will prepare according to your demand.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; Dshi_3030; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Target Names
atpB
Target Protein Sequence
MATEEGTGLTFYPMDQFIVSPLFGDGPVHFYTPTNVTLWMALAVAAIALLLVAGTRGRAV VPSRAQSIAELAYGFVYKMVEDVTGKDGIKYFPYIFTLFMFILVANFLGLIPMSFTTTSH IAVTAVLALAVFITVTVIGFVKNGAGFLSLFWVASAPLALRPILAVIEIISYFVRPVSHS IRLAGNMMAGHAVLKVFAGFAQVAAVAPIAIIGVMAIYGLEVLVSAIQAYVFTILTCVYL KDALHPHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, it plays a direct role in facilitating proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does D. shibae ATP synthase contribute to the organism's bioenergetics?

D. shibae ATP synthase plays a crucial role in the organism's remarkable bioenergetic adaptability. Unlike most organisms, D. shibae can rapidly regenerate ATP levels following anoxic conditions. The ATP synthase complex, with atpB as a key component, utilizes the membrane potential (ΔΨ) rather than the pH gradient (ΔpH) as the primary component of its proton-motive force .

Research has shown that D. shibae can lose up to 90% of its intracellular ATP during anoxia but can quickly recover when oxygen becomes available. Interestingly, the membrane potential actually increases during anoxia, which is unusual compared to other bacteria. This boosted membrane potential allows for rapid ATP regeneration once oxygen is reintroduced .

What experimental systems are suitable for studying recombinant D. shibae atpB protein?

For effective study of recombinant D. shibae atpB, researchers should consider:

  • Expression Systems: E. coli has been successfully used to express the recombinant protein with N-terminal His tags .

  • Protein Handling: The recombinant protein is typically supplied as a lyophilized powder and should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol for long-term storage .

  • Membrane Potential Measurement Systems: Fluorescence microscopy with carbocyanine dyes such as DiOC₂(3) and JC-10 can be used to visualize membrane potential changes .

  • Control Organisms: For comparative studies, Escherichia coli and Micrococcus luteus can serve as Gram-negative and Gram-positive control organisms, respectively .

How does the membrane potential (ΔΨ) in D. shibae behave differently during anoxia compared to other bacteria?

Comparative Membrane Potential Behavior During Anoxia:

OrganismMembrane Potential Response to AnoxiaRecovery Upon Re-aeration
D. shibaeIncreasesRapid ATP regeneration
E. coli (control)DecreasesGradual recovery
M. luteus (control)DecreasesGradual recovery

This unusual bioenergetic response is believed to be an adaptation to D. shibae's lifestyle as an epibiont of dinoflagellates, where it experiences frequent transitions between oxic and anoxic conditions. By maintaining an elevated membrane potential during anoxia, D. shibae positions itself for rapid ATP regeneration once oxygen becomes available again, giving its metabolism a "flying start" .

Methodologically, researchers can investigate this phenomenon using:

  • Membrane potential-sensitive fluorescent dyes

  • Controlled environments for creating and monitoring oxic-anoxic transitions

  • Real-time ATP measurements correlated with membrane potential changes

What is the relationship between ATP synthase function and D. shibae's ability to survive in fluctuating oxygen environments?

D. shibae's ecological niche as an epibiont of dinoflagellates subjects it to frequent changes in oxygen availability. Its ATP synthase, including the atpB subunit, plays a central role in the organism's adaptation to these conditions .

The relationship can be understood through several interconnected mechanisms:

  • Rapid Bioenergetic Adaptation: During anoxia, D. shibae loses up to 90% of its ATP but can regenerate it within 40 seconds upon re-aeration .

  • Membrane Potential Boosting: The increased membrane potential during anoxia primes the ATP synthase for immediate activity when oxygen returns .

  • Photosynthetic Contribution: Light supports proton translocation in D. shibae, contributing to ATP regeneration. This photoheterotrophic capability provides an additional energy source that complements respiratory ATP production .

  • Alternative Respiratory Pathways: D. shibae can switch between aerobic respiration and anaerobic processes like denitrification, which allows continued ATP synthase function under various conditions .

These mechanisms collectively enable D. shibae to maintain energy homeostasis despite environmental fluctuations, with ATP synthase serving as the central machinery for energy currency production.

What methodological approaches are most effective for studying atpB function in the context of D. shibae's unusual bioenergetics?

To investigate the unique properties of D. shibae atpB in the context of its unusual bioenergetics, researchers should consider the following methodological approaches:

  • Reconstitution Studies: Purified recombinant atpB can be reconstituted into liposomes to study its specific contribution to proton translocation and membrane potential generation .

  • Site-Directed Mutagenesis: Key residues in the atpB sequence can be altered to determine their roles in the protein's function, particularly those potentially involved in the unusual membrane potential response to anoxia.

  • Comparative Bioenergetic Analysis: Techniques that simultaneously measure ΔpH, ΔΨ, and ATP levels during oxic-anoxic transitions provide comprehensive insights. The butanol permeabilization method of Scholes and Mitchell can be used for ΔpH analysis, while fluorescent probes monitor ΔΨ .

  • Oxygen-Controlled Cultivation:

    • Culture D. shibae in artificial seawater medium with 10 mM succinate

    • Maintain diurnal light/dark rhythm (12h/12h, 12 μmol photons m⁻² s⁻¹)

    • Incubate at 25°C with shaking at 125 rpm

    • Control oxygen levels precisely using specialized fermentation equipment

  • Integrated Transcriptomic and Proteomic Analysis: Combine functional studies of atpB with gene expression data to understand regulatory networks, particularly focusing on the relationship between anaerobic adaptation and ATP synthase expression .

How does the regulatory network controlling oxygen adaptation interact with ATP synthase expression in D. shibae?

D. shibae employs a sophisticated regulatory network to adapt to changing oxygen concentrations, which directly impacts ATP synthase expression and function. This network involves multiple interconnected systems:

  • Fnr-Dnr Regulatory Cascade: Oxygen-sensing regulator Fnr and several Dnr proteins form a regulatory cascade that controls the expression of genes involved in anaerobic metabolism. This likely includes modulation of ATP synthase components to optimize energy conservation under different oxygen conditions .

  • Iron-Oxygen Regulatory Intersection: The anaerobic regulatory system is closely connected to iron acquisition pathways, as anaerobic regulators depend on iron-containing cofactors such as [FeS]-clusters or heme. Three potential ferric uptake regulator (Fur) genes have been identified in the D. shibae genome, suggesting complex iron-dependent regulation .

  • Light-Dependent Regulation: The LOV-protein LdaP responds to blue light and may influence ATP synthase function by affecting the photoheterotrophic capabilities of D. shibae .

Methodological approach for studying this regulatory network:

  • Construct knockout mutants of key regulatory genes

  • Measure ATP synthase expression and activity under various oxygen conditions

  • Monitor membrane potential changes in regulatory mutants

  • Perform chromatin immunoprecipitation to identify direct regulatory interactions

What are the critical differences between native and recombinant D. shibae atpB that researchers should consider in experimental design?

When working with recombinant D. shibae atpB protein, researchers must account for several differences from the native form that could impact experimental outcomes:

FactorNative atpBRecombinant atpBExperimental Consideration
Post-translational modificationsMay have native modificationsLikely lacks modifications from E. coli expressionVerify functional equivalence
Membrane environmentIntegrated in native lipid compositionStudied in artificial membranes or E. coli lipidsUse liposomes with similar lipid composition to D. shibae
Protein interactionsInteracts with other D. shibae F₀F₁ componentsIsolated or in non-native complexesCo-expression with other ATP synthase components may be necessary
Affinity tagsNoneContains His-tag at N-terminusTag may affect protein folding or function
Salt requirementsAdapted to marine environment (1-7% salinity)Expression in E. coli has different salt conditionsBuffer conditions should mimic marine environment

Methodologically, researchers should:

  • Compare the activities of native membrane preparations with reconstituted recombinant protein

  • Consider tag removal for certain functional studies

  • Perform complementation studies in atpB knockout strains

  • Validate structural integrity through circular dichroism or other spectroscopic methods

How can recombinant D. shibae atpB be utilized as a model system for studying bioenergetic adaptation?

Recombinant D. shibae atpB provides an excellent model system for investigating fundamental aspects of bioenergetic adaptation, particularly in environments with fluctuating oxygen levels. Researchers can utilize this protein to:

  • Study Membrane Potential Regulation: The unusual increase in membrane potential during anoxia makes D. shibae atpB an ideal model for investigating alternative bioenergetic strategies in prokaryotes .

  • Investigate Rapid Recovery Mechanisms: By reconstituting the protein into liposomes and subjecting them to controlled oxic-anoxic transitions, researchers can elucidate the molecular mechanisms behind D. shibae's remarkable ATP regeneration capabilities .

  • Examine Protein-Lipid Interactions: The function of membrane proteins like atpB is strongly influenced by their lipid environment. Systematic studies with varying lipid compositions can reveal how membrane properties affect ATP synthase function during environmental transitions.

To implement these applications, researchers should:

  • Express atpB with compatible ATP synthase components

  • Develop reconstitution protocols that preserve functional activity

  • Employ real-time monitoring of membrane potential and ATP synthesis

  • Compare results with other bacterial ATP synthases to highlight the unique properties of the D. shibae system

What protocols should be optimized when working with recombinant D. shibae atpB for functional studies?

For optimal functional studies with recombinant D. shibae atpB, researchers should focus on optimizing several critical protocols:

  • Protein Reconstitution Protocol:

    • Reconstitute lyophilized protein in deionized sterile water

    • Adjust to 0.1-1.0 mg/mL concentration

    • Add glycerol (5-50% final concentration) for stability

    • Aliquot and store at -20°C/-80°C to avoid freeze-thaw cycles

  • Membrane Potential Measurement:

    • Use carbocyanine dyes (DiOC₂(3) or JC-10) for fluorescence microscopy

    • Include appropriate controls with ionophores like CCCP (carbonyl cyanide m-chlorophenyl hydrazone), TCS (3,3′,4′,5-tetrachlorosalicylanilide), or gramicidin

    • Calibrate fluorescence signals against known membrane potential values

  • ATP Synthase Activity Assay:

    • Monitor ATP production under varying oxygen conditions

    • Create precisely controlled oxic-anoxic transitions

    • Measure ATP levels using luciferase-based assays for real-time monitoring

  • Salt and pH Optimization:

    • Maintain conditions that reflect D. shibae's natural marine environment

    • Use artificial seawater medium for functional studies

    • Maintain pH between 6.5-9.0 (optimal range for D. shibae)

  • Light Exposure Protocol:

    • Control light exposure (12 μmol photons m⁻² s⁻¹) to account for photoheterotrophic effects

    • Compare function in light vs. dark conditions to assess light-dependent ATP production

What are the common challenges in expressing and purifying functional recombinant D. shibae atpB?

Researchers working with recombinant D. shibae atpB often encounter several challenges that can impact protein quality and experimental outcomes:

  • Membrane Protein Solubility: As a transmembrane protein, atpB may form inclusion bodies during heterologous expression in E. coli.

    • Solution: Optimize expression conditions by lowering temperature (16-20°C), using specialized E. coli strains designed for membrane proteins, or adding solubilizing agents.

  • Protein Misfolding: The protein may not achieve its native conformation when expressed in E. coli.

    • Solution: Co-express with chaperones or use mild detergents for extraction that promote proper folding.

  • Loss of Activity During Purification: Harsh purification conditions may compromise protein function.

    • Solution: Use gentle extraction methods with appropriate detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that maintain protein-lipid interactions.

  • Salt Requirements: As a marine bacterium protein, atpB may require specific salt conditions for stability.

    • Solution: Include appropriate salt concentrations (matching D. shibae's 1-7% salinity requirement) in all buffers .

  • Protein Degradation: Storage conditions may lead to protein degradation.

    • Solution: Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0, add glycerol to 50% final concentration, and aliquot to avoid freeze-thaw cycles .

How should researchers interpret conflicting data regarding membrane potential measurements in D. shibae?

When encountering conflicting membrane potential (ΔΨ) data in D. shibae studies, researchers should consider several factors that could contribute to discrepancies:

  • Dye Selection Effects: Different potential-sensitive dyes (e.g., DiOC₂(3) vs. JC-10) may yield different results due to varying sensitivity, cellular uptake, and potential-independent binding .

    • Resolution Approach: Validate findings using multiple independent dyes and complement with electrophysiological methods when possible.

  • Growth Phase Variability: The bioenergetic state of D. shibae varies significantly depending on growth phase.

    • Resolution Approach: Standardize experiments to use cultures at the same growth phase (preferably mid-log) and document the OD₆₀₀ values.

  • Light Exposure Differences: As a photoheterotroph, D. shibae's membrane potential is influenced by light exposure .

    • Resolution Approach: Control and document light conditions precisely during experiments and pre-growth.

  • Oxygen Transition Kinetics: The rate of oxygen depletion/introduction affects membrane potential dynamics.

    • Resolution Approach: Use standardized protocols for creating anoxia and monitor oxygen levels continuously.

When conflicting data emerge, consider constructing a comprehensive data interpretation table:

FactorPossible Impact on ΔΨ MeasurementVerification Method
Culture densityHigher density may limit oxygen diffusionStandardize OD₆₀₀ and verify with cell counting
Medium compositionAffects baseline energeticsUse defined artificial seawater medium
Temperature fluctuationsAlter membrane fluidity and protein functionControl temperature at 25°C
Transition timeRapid vs. gradual oxygen changes elicit different responsesDocument exact timing of transitions
Previous exposure historyCells adapt to repeated anoxic exposureUse fresh cultures with documented history

What emerging techniques could advance our understanding of D. shibae atpB structure-function relationships?

Several cutting-edge techniques show promise for elucidating the structure-function relationships of D. shibae atpB:

  • Cryo-Electron Microscopy (Cryo-EM): This technique could reveal the structural basis for D. shibae ATP synthase's unique properties, particularly how atpB contributes to the increased membrane potential during anoxia.

  • Single-Molecule FRET: By labeling strategic residues within atpB, researchers could monitor conformational changes during proton translocation in real-time, especially during oxic-anoxic transitions.

  • In-cell NMR Spectroscopy: This emerging approach could allow observation of atpB dynamics within intact cells under various oxygen conditions.

  • Artificial Intelligence-Based Structure Prediction: Tools like AlphaFold2 could predict structural changes in atpB under different conditions and guide experimental design.

  • Nanodiscs Technology: Incorporating atpB into nanodiscs would provide a more native-like membrane environment than detergent micelles, potentially preserving functionality better for structural studies.

  • Optogenetic Control: Developing systems to modulate ATP synthase activity using light could enable precise temporal control for studying the dynamics of bioenergetic adaptation.

Implementation of these techniques would provide unprecedented insights into how the structure of atpB contributes to D. shibae's remarkable bioenergetic adaptability during environmental transitions.

How might understanding D. shibae atpB function contribute to broader research on bacterial adaptation to environmental stress?

The unusual properties of D. shibae atpB and its role in bioenergetic adaptation provide a valuable model system that could inform broader research on bacterial stress responses:

  • Novel Bioenergetic Strategies: The increased membrane potential during anoxia in D. shibae represents an alternative strategy for energy conservation that could exist in other extremophiles or bacteria from variable environments .

  • Ecological Resilience Mechanisms: Understanding how D. shibae rapidly recovers from energy depletion could inform research on bacterial persistence in fluctuating environments, particularly marine ecosystems affected by climate change.

  • Evolution of Symbiotic Relationships: As an epibiont of dinoflagellates, D. shibae's adaptations reflect co-evolution with its host. This system could serve as a model for studying how bioenergetic adaptations facilitate symbiotic relationships .

  • Cross-Kingdom Energy Transfer: The relationship between D. shibae's ATP synthase function and its ability to provide vitamins to dinoflagellate hosts represents a model for studying energy and nutrient exchange in microbial communities .

Future research directions could include:

  • Comparative genomics of ATP synthases across the Roseobacter clade to identify adaptations specific to different ecological niches

  • Investigation of potential horizontal gene transfer events that may have contributed to D. shibae's unique bioenergetic properties

  • Development of synthetic biology applications based on D. shibae's rapid energy recovery mechanisms

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.