Recombinant Dinoroseobacter shibae Glycerol-3-phosphate acyltransferase (plsY)

What is the basic structure and function of Dinoroseobacter shibae plsY?

Dinoroseobacter shibae plsY (A8LL79) is a 203-amino acid integral membrane protein that functions as glycerol-3-phosphate acyltransferase. The protein catalyzes the transfer of acyl groups from acylphosphate to glycerol-3-phosphate, a critical step in bacterial phospholipid biosynthesis. The full amino acid sequence is: MPELTTAPGLLALVGLAAYLLGAIPFGLLIAKLFGLGNLREIGSGNIGATNVLRTGSKPAAAATLILDAGKGAFAVILARVLVGEDAAQIAGAAAFLGHCFPVYLKFNGGKGVATFFGTVIALSWPLGLAAGAIWLATAYTFRISSLSALMAALMTPIFAWGFGQRELVVLSLFLGFLIWIRHRENIIRLLSGTEPRIGAKKR . Studies on related plsY proteins reveal a characteristic membrane topology with five membrane-spanning segments, with the amino terminus and two short loops located on the external face of the membrane, while three larger cytoplasmic domains contain highly conserved sequence motifs critical for catalytic activity .

How does D. shibae plsY compare to plsY proteins from other bacterial species?

D. shibae plsY shares significant structural similarities with other bacterial plsY proteins, particularly in the conserved catalytic domains. Comparative analyses of plsY from different bacterial species, including the well-studied Streptococcus pneumoniae plsY, show that these proteins generally contain three highly conserved sequence motifs. Motif 1 typically includes essential serine and arginine residues critical for catalysis. Motif 2 resembles a phosphate-binding loop and is involved in glycerol-3-phosphate binding, as demonstrated by mutagenesis studies showing increased Km values for glycerol-3-phosphate when conserved glycines in this motif are mutated to alanines. Motif 3 contains conserved histidine and asparagine residues important for activity, along with a glutamate residue crucial for structural integrity . This high conservation suggests the functional importance of these domains across bacterial species.

What expression systems are optimal for producing recombinant D. shibae plsY?

For recombinant expression of D. shibae plsY, E. coli has been successfully employed as a heterologous host system. The commercially available recombinant full-length D. shibae plsY (1-203aa) has been expressed in E. coli with an N-terminal His-tag . When designing expression systems, researchers should consider the membrane-bound nature of this protein. Expression vectors containing strong promoters like T7 or tac are generally recommended, but expression levels should be carefully optimized to prevent aggregation of this membrane protein. Induction conditions (temperature, inducer concentration, induction time) should be systematically tested to maximize soluble protein yield. For membrane proteins like plsY, lower induction temperatures (16-20°C) and moderate inducer concentrations often yield better results than standard protocols for soluble proteins.

What purification strategies are most effective for obtaining high-purity D. shibae plsY?

Purification of D. shibae plsY typically begins with membrane fraction isolation followed by detergent solubilization. Since commercially available recombinant plsY contains an N-terminal His-tag , immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is the primary purification method. Buffer optimization is critical—buffers containing appropriate detergents (such as n-dodecyl-β-D-maltoside or CHAPS) at concentrations above their critical micelle concentration are essential for maintaining protein solubility and activity. Following IMAC, size exclusion chromatography can further enhance purity. For functional studies, researchers should verify that the purified protein retains its native conformation and activity. The lyophilized recombinant protein should be reconstituted in appropriate buffers, with manufacturers recommending deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

What are the optimal assay conditions for measuring D. shibae plsY activity?

The enzymatic activity of D. shibae plsY can be assessed by measuring the transfer of acyl groups from acylphosphate to glycerol-3-phosphate. Based on studies of similar bacterial plsY enzymes, activity assays should be conducted at physiologically relevant conditions that reflect D. shibae's natural environment. Since D. shibae is a marine bacterium that grows optimally at 33°C and pH 6.5-9.0 with 1-7% salinity , initial activity screens should include these parameters. The assay buffer should contain appropriate salt concentrations (typically NaCl), and detergent concentrations should be carefully optimized to maintain enzyme solubility without inhibiting activity. Substrate concentrations should be titrated to determine Km values for both acylphosphate and glycerol-3-phosphate. Activity can be measured either by quantifying product formation (acylated glycerol-3-phosphate) via HPLC or mass spectrometry, or by coupling the reaction to other detectable enzymatic reactions.

How do mutations in conserved domains affect D. shibae plsY activity?

Based on studies of plsY from other bacterial species, mutations in the three conserved motifs significantly impact enzymatic activity. In Motif 1, mutations of the conserved serine and arginine residues would likely abolish catalytic activity, as these residues are essential for substrate binding and catalysis. Mutations in Motif 2, particularly of the conserved glycines, would be expected to increase the Km for glycerol-3-phosphate binding, as demonstrated in S. pneumoniae plsY . For Motif 3, mutations of the conserved histidine and asparagine would likely reduce activity, while mutation of the conserved glutamate would disrupt protein structural integrity . Site-directed mutagenesis studies targeting these conserved residues in D. shibae plsY would provide valuable insights into the specific roles of these residues in the context of this particular bacterial species and could reveal species-specific functional adaptations.

What inhibitors affect D. shibae plsY activity and how can they be used in research?

Based on studies of plsY from other bacterial species, acyl-CoA compounds like palmitoyl-CoA can act as noncompetitive inhibitors . For D. shibae plsY specifically, inhibitor screening should include compounds that interact with the active site residues identified in the conserved motifs. Potential inhibitor classes include acyl-phosphate analogs, glycerol-3-phosphate analogs, and compounds targeting the membrane domains. When conducting inhibitor studies, researchers should employ enzyme kinetic analyses to determine inhibition constants (Ki) and inhibition mechanisms (competitive, noncompetitive, or uncompetitive). These inhibitors can be valuable tools for studying the role of plsY in phospholipid biosynthesis and for developing potential antimicrobial agents targeting phospholipid biosynthesis in related pathogenic bacteria.

How is plsY expression regulated in D. shibae under different growth conditions?

The regulation of plsY expression in D. shibae likely responds to environmental factors and growth conditions. While specific data on D. shibae plsY regulation is limited, researchers could investigate expression patterns using qRT-PCR under various growth conditions relevant to D. shibae's natural habitat. These conditions might include aerobic versus anaerobic growth, different light intensities (as D. shibae is a photoheterotroph) , various carbon sources, nutrient limitation, and oxidative stress conditions. D. shibae has been shown to respond to oxidative stress and starvation , so examining plsY expression under these conditions would be particularly relevant. Researchers should design primers specific to the D. shibae plsY gene and validate them to ensure they don't amplify homologous genes from other species such as E. coli . Experimental designs should include appropriate controls and normalization to reference genes that maintain stable expression under the tested conditions.

What is the role of plsY in D. shibae's membrane vesicle formation?

D. shibae forms outer membrane vesicles (OMVs) during normal growth, and these vesicles contain DNA . The role of plsY in OMV formation represents an intriguing research question. As a key enzyme in phospholipid biosynthesis, plsY likely influences membrane composition and properties, which could affect OMV formation. To investigate this relationship, researchers could employ a genetic approach by creating plsY mutants with altered activity levels and assessing changes in OMV production, size, composition, and DNA content. Microscopy techniques, particularly time-lapse microscopy which has been used to capture instances of OMV production at the septum during cell division , would be valuable for these studies. Additionally, lipidomic analysis of OMVs from wild-type and plsY mutant strains could reveal how alterations in plsY activity affect the lipid composition of these vesicles.

How can D. shibae plsY be used as a model for studying bacterial membrane biogenesis?

D. shibae plsY serves as an excellent model for studying bacterial membrane biogenesis due to several factors. First, D. shibae belongs to the Roseobacter clade, which is ecologically significant in marine environments . Second, unlike many members of this clade which are obligate aerobes, D. shibae is a facultative anaerobe , allowing researchers to study membrane biogenesis under both aerobic and anaerobic conditions. To use D. shibae plsY as a model system, researchers could employ a combination of biochemical, genetic, and biophysical approaches. These might include creating conditional plsY mutants to study the effects of altered phospholipid biosynthesis on membrane properties, using fluorescently tagged plsY to visualize its localization during cell growth and division, and employing mass spectrometry-based lipidomics to characterize how changes in plsY activity affect membrane lipid composition. This research could provide insights into the adaptation of membrane biogenesis to different environmental conditions in marine bacteria.

What approaches can be used to study the interaction of D. shibae plsY with other proteins in the phospholipid biosynthesis pathway?

To study protein-protein interactions involving D. shibae plsY, researchers can employ multiple complementary approaches. Bacterial two-hybrid systems can be used for initial screening of potential interaction partners, focusing on proteins involved in phospholipid biosynthesis such as PlsX, which converts acyl-acyl carrier protein to acylphosphate before PlsY transfers the acyl group to glycerol-3-phosphate . Co-immunoprecipitation with anti-His antibodies can be used with the His-tagged recombinant plsY to pull down interacting proteins from D. shibae lysates. For more detailed characterization of specific interactions, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) can determine binding kinetics and thermodynamic parameters. Structural approaches such as X-ray crystallography or cryo-electron microscopy might reveal the molecular basis of these interactions, though these may be challenging for membrane proteins like plsY. Functional assays could assess how these interactions affect enzymatic activity, potentially revealing regulatory mechanisms in the phospholipid biosynthesis pathway.

How can researchers overcome common challenges in working with recombinant D. shibae plsY?

Working with recombinant membrane proteins like D. shibae plsY presents several challenges. One common issue is low expression levels or protein aggregation. To address this, researchers should optimize expression conditions by testing different E. coli strains (such as C41(DE3) or C43(DE3) designed for membrane protein expression), lower induction temperatures (16-20°C), and various inducer concentrations. Adding specific lipids or detergents to growth media can sometimes improve membrane protein folding.

Another challenge is maintaining protein stability during purification and storage. Researchers should thoroughly test different detergents for solubilization, considering both their efficiency in extracting the protein and their compatibility with downstream applications. For storage, adding glycerol (5-50%) and aliquoting the protein before freezing at -20°C/-80°C can help maintain activity . Avoiding repeated freeze-thaw cycles is crucial .

For activity assays, inconsistent results often arise from variation in substrate preparation or assay conditions. Researchers should ensure that acylphosphate substrates (which are relatively unstable) are freshly prepared or properly stored, and that assay conditions (pH, salt concentration, temperature) are precisely controlled and optimized for D. shibae plsY.

What are the best approaches for resolving inconsistent results in D. shibae plsY activity assays?

When encountering inconsistent results in plsY activity assays, researchers should systematically troubleshoot potential sources of variation. First, verify protein quality by assessing purity via SDS-PAGE and measuring protein concentration using methods less affected by detergents, such as amino acid analysis or specific absorbance. Second, examine substrate quality—acylphosphate substrates can degrade rapidly, so freshly prepared substrates or careful qualification of stored substrates is essential. Third, thoroughly control experimental conditions, including temperature, pH, buffer composition, and detergent concentration.

Statistical approaches can help identify sources of variation—design experiments with technical and biological replicates, use appropriate statistical tests to analyze variability, and employ methods like ANOVA to identify significant factors affecting assay results. Consider developing internal controls, such as parallel assays with well-characterized enzymes or standard curves with known product quantities, to normalize results across experiments.

Finally, cross-validate activity measurements using complementary methods—for example, comparing results from direct product detection via HPLC or mass spectrometry with coupled enzyme assays measuring the same reaction.

How does D. shibae plsY compare with plsY from other marine bacteria in structure and function?

Comparative analysis of D. shibae plsY with homologs from other marine bacteria can provide insights into adaptation mechanisms for different marine environments. While specific comparative data for D. shibae plsY is limited in the search results, researchers interested in this question should perform sequence alignments and phylogenetic analyses of plsY sequences from various marine bacteria, particularly focusing on comparisons between bacteria from different marine niches (coastal vs. deep sea, different temperature ranges, etc.).

Based on the available information about plsY structure and function, researchers should examine conservation patterns in the three key motifs identified in other plsY proteins . For instance, comparing the glycerol-3-phosphate binding site (Motif 2) across marine bacterial species might reveal adaptations related to different membrane compositions in various marine environments. Homology modeling based on existing plsY structures could predict structural differences that might be related to functional adaptations.

For functional comparisons, enzyme kinetic parameters (Km, kcat, substrate specificity) should be determined for plsY from multiple marine bacterial species under standardized conditions, allowing direct comparison of catalytic efficiencies and substrate preferences.

What evolutionary insights can be gained from studying D. shibae plsY in relation to other acyltransferases?

Evolutionary analysis of D. shibae plsY can provide insights into the development and diversification of phospholipid biosynthesis pathways. Researchers should construct phylogenetic trees incorporating plsY sequences from diverse bacterial phyla, with particular attention to alphaproteobacteria like D. shibae. Comparison with other acyltransferase families, including those involved in alternative phospholipid biosynthesis pathways, could reveal evolutionary relationships and potential cases of convergent evolution.

Additionally, genomic context analysis examining the organization of genes surrounding plsY in D. shibae compared to other bacteria could provide insights into the co-evolution of functionally related genes in phospholipid biosynthesis pathways.