Recombinant Dinoroseobacter shibae Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Description

Functional Role in Membrane Protein Biogenesis

YidC operates via two pathways:

  1. Sec-Independent Insertion: Direct integration of small membrane proteins (e.g., Pf3 coat) into lipid bilayers .

  2. Sec-Dependent Collaboration: Cooperative folding of multi-spanning proteins with the Sec translocon .

In D. shibae, YidC may facilitate the insertion of:

  • Metabolic enzymes critical for symbiotic interactions with dinoflagellates .

  • Outer membrane vesicle (OMV) components, given its role in DNA-enriched OMV production .

Substrate Interaction Dynamics

  • Electrostatic Guidance: Negatively charged substrates (e.g., Pf3 coat D7/D18) bind to positively charged residues in YidC’s groove, initiating insertion .

  • Conformational Flexibility: Molecular dynamics simulations show YidC undergoes structural rearrangements during substrate translocation .

In Vitro Reconstitution

  • Proteoliposome Studies: E. coli YidC inserts ~150 Pf3 coat molecules per YidC copy, demonstrating catalytic efficiency . Recombinant D. shibae YidC would likely exhibit similar activity.

  • Energy Independence: Unlike Sec-dependent pathways, YidC-mediated insertion does not require ATP .

Table 2: Key Experimental Findings for YidC

Study TypeKey InsightReference
CrystallographyHydrophilic groove essential for function
Cysteine-scanningCytoplasmic loops critical for ribosome binding
Proteoliposome assaysCatalytic insertion of Pf3 coat protein

Applications of Recombinant YidC

  • Membrane Protein Production: Enables high-yield expression of challenging membrane proteins for structural studies .

  • Biotechnological Engineering: Manipulation of bacterial membrane systems for synthetic biology applications .

  • Symbiosis Research: Investigating YidC’s role in D. shibae’s mutualistic-pathogenic switch with dinoflagellates .

Future Directions

  • Structural Resolution: Cryo-EM studies of D. shibae YidC-ribosome complexes to elucidate species-specific adaptations .

  • Substrate Profiling: Identifying D. shibae-specific YidC substrates via proteomics .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery details, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Dshi_0328; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-606
Protein Length
full length protein
Species
Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Target Names
yidC
Target Protein Sequence
MDDQNKNLILATALSFLVILVWFLLFPPEEPVTDPNAPTQITQSGETADVALTPPAAVTE AAPGAAPQTAATPTENAPRVQIDTPALEGSISLLGGRIDDLSLRNYNETLEPDSPIVRLL SPVDAPGAYYALYGWAPAGTLSFDDVPGANTLWTVESGDTLTVDTPVVLRWENGNGLIFR RTLAVDDDFMFTVTQSVENTTETDKRMQPYGIIARHGEPDTINFFVLHEGVVAMADGSLI ESDYDDMLDYDFVEREGARAEVEQIEQNGWIGFTDKNWMTTLIPTPGQPFTSVAKYVGNA DIYQTETRLPTQTVPGGQTVTVETRLFAGAKEWEAIRGYERELGIEGFIDSIDWGWFYFL TKPIFFVLHELNLLIGNMGVAIIVLTLLIKALLLPLAWKSYVSMARMKELQPEMEKLKEK AGDDRQKLQVAMMELYKKEKVNPAAGCLPILLQIPIFFSLYKVIFVTIELRHAPFFGPFQ DLSAPDPTSIMNLFGLLPFASPEPGSILALIFIGILPLLLGISMWLQQKLNPAPTDPTQA MIFAWLPWVFMFMLGTFASGLIVYWIANNVITFAQQYFIMRRHGYKPDLFGNIVASFKKK KPSEDK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Plays a role in the integration of membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in the folding of multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Membrane Protein Insertase YidC in Dinoroseobacter shibae?

YidC in Dinoroseobacter shibae is a 606-amino acid membrane protein that belongs to the YidC/Oxa1/Alb3 family of membrane protein insertases. This protein family facilitates the insertion and assembly of membrane proteins across various cellular systems including bacteria, mitochondria, and chloroplasts . In Dinoroseobacter shibae, a marine bacterium belonging to the Rhodobacteraceae family, YidC plays a crucial role in protein integration into the membrane .

The biological significance of YidC extends beyond basic membrane protein integration. Dinoroseobacter shibae exhibits a "Jekyll-and-Hyde" relationship with dinoflagellates like Prorocentrum minimum, initially providing essential vitamins in a symbiotic relationship before transitioning to a pathogenic state . As a membrane protein insertase, YidC likely contributes to assembling protein complexes essential for both phases of this relationship.

What is the mechanism by which YidC/Oxa1 proteins facilitate membrane protein insertion?

Cryo-electron microscopy studies have revealed that both E. coli YidC and Saccharomyces cerevisiae Oxa1 (a mitochondrial homolog) form dimeric insertion pores on the translating ribosome . These dimers are localized above the exit of the ribosomal tunnel, positioning them optimally to facilitate co-translational membrane protein insertion.

The insertion mechanism involves several key components and interactions:

  • YidC dimers contact the ribosome at specific sites, including ribosomal protein L23 and conserved rRNA helices 59 and 24

  • This contact pattern is remarkably similar to that observed for the non-homologous SecYEG translocon, suggesting convergent evolution toward an optimal ribosome-translocon interface

  • The dimer configuration creates a protected environment for nascent membrane proteins to fold and insert into the lipid bilayer

These structural arrangements suggest that YidC dimers form insertion pores with an architecture conceptually similar to the SecY monomer, despite their different evolutionary origins .

How does ribosome binding affect YidC function and oligomeric state?

Crosslinking experiments have demonstrated that ribosome binding specifically stabilizes the dimeric state of both YidC and Oxa1 . This represents a fascinating regulatory mechanism where the functional oligomeric state of the insertase is induced by interaction with the ribosome.

The stabilization of YidC dimers by ribosome binding has several functional implications:

  • It ensures that active insertion pores form only when and where they are needed—at translating ribosomes producing membrane proteins

  • It coordinates insertion activity with translation, preventing premature or mislocalized membrane protein insertion

  • It may allow for regulation of insertion activity through modulation of ribosome-YidC interactions

To experimentally investigate this phenomenon, researchers typically employ techniques such as site-specific crosslinking, fluorescence resonance energy transfer (FRET), or analytical ultracentrifugation to monitor oligomeric states under different conditions.

What methods are most effective for expressing and purifying recombinant D. shibae YidC?

The successful expression and purification of membrane proteins like YidC present unique challenges due to their hydrophobic nature. Based on available information, the following protocol has proven effective for D. shibae YidC:

Expression System:

  • Expression host: Escherichia coli

  • Construct: Full-length D. shibae YidC (606 amino acids) with N-terminal His-tag

  • Purification quality: >90% as determined by SDS-PAGE

Storage and Handling Recommendations:

  • Final form: Lyophilized powder

  • Buffer composition: Tris/PBS-based buffer containing 6% trehalose, pH 8.0

  • Reconstitution: Deionized sterile water to 0.1-1.0 mg/mL

  • Long-term storage: Add 5-50% glycerol (final concentration) and store at -20°C/-80°C

  • Stability note: Avoid repeated freeze-thaw cycles

For functional studies, researchers should consider reconstituting the purified protein into liposomes of defined composition or utilizing detergent-based systems that maintain native structure and activity.

What approaches can be used to study YidC-ribosome interactions?

Multiple complementary techniques have proven valuable for investigating YidC-ribosome interactions:

Structural Studies:

  • Cryo-electron microscopy (cryo-EM): Successfully used to determine structures of both E. coli YidC and S. cerevisiae Oxa1 bound to E. coli ribosome nascent chain complexes

  • Crosslinking experiments: Identified dimer interfaces and ribosome contact sites

  • Molecular dynamics simulations: Can provide insights into dynamic aspects of the interaction

Biochemical Approaches:

  • Ribosome binding assays: To quantify affinity and kinetics

  • Site-directed mutagenesis: To identify critical residues

  • Reconstitution systems: To assess functional consequences of interactions

These approaches have revealed that YidC dimers contact the ribosome at specific sites (ribosomal protein L23 and rRNA helices 59 and 24), similar to the interaction pattern observed with the SecYEG translocon despite their distinct structures .

How might YidC function relate to D. shibae's ecological interactions?

Dinoroseobacter shibae displays a fascinating "Jekyll-and-Hyde" relationship with dinoflagellates like Prorocentrum minimum—initially providing essential vitamins B12 and B1 in a symbiotic relationship before transitioning to a pathogenic state that kills the dinoflagellate .

While direct evidence linking YidC to this relationship is not available in the current literature, as a membrane protein insertase, YidC likely plays several critical roles:

  • Assembly of membrane transporters involved in vitamin export during the symbiotic phase

  • Integration of membrane-associated virulence factors required for the pathogenic phase

  • Adaptation of membrane composition in response to environmental signals

The genetic basis for D. shibae's killing phenotype has been linked to a 191 kb plasmid (pDS191) . YidC would be essential for properly integrating any membrane proteins encoded by this plasmid that contribute to the killing mechanism.

What is the relationship between YidC function and outer membrane vesicle (OMV) formation in D. shibae?

Dinoroseobacter shibae constitutively secretes outer membrane vesicles (OMVs) containing DNA during normal growth . Interestingly, time-lapse microscopy has captured instances of multiple OMV production occurring at the septum during cell division, and the DNA contained within these vesicles is enriched up to 22-fold for the region around the terminus of replication (ter) .

The potential connections between YidC and OMV formation include:

  • YidC likely inserts membrane proteins involved in OMV biogenesis

  • The enrichment of DNA from the replication terminus region in OMVs suggests a specialized machinery for DNA packaging that may include YidC-dependent components

  • The observation that OMVs form at the septum during cell division coincides with the location of many membrane remodeling events that require YidC activity

The DNA enrichment peak in OMVs is located at dif, a conserved 28-bp palindromic sequence required for binding site-specific tyrosine recombinases XerC/XerD, which are activated at the last stage of cell division . This suggests a mechanistic link between cell division, DNA processing, and OMV formation that merits further investigation.

How might studying D. shibae YidC contribute to understanding bacterial adaptation to marine environments?

As a marine bacterium, Dinoroseobacter shibae has evolved to thrive in specific ecological niches, including as a symbiont of dinoflagellates . Studying YidC from this organism could provide insights into several aspects of marine bacterial adaptation:

  • Membrane composition adaptation: Marine bacteria often have specialized membrane compositions to deal with salt stress and pressure. YidC may have evolved to handle substrates with unique marine-adapted properties.

  • Symbiotic interface specialization: The membrane represents the interface between D. shibae and its dinoflagellate partners. YidC's role in assembling membrane proteins involved in this interaction may reveal specialized features.

  • Environmental responsiveness: YidC activity or specificity might be regulated in response to marine-specific environmental cues, such as changes in salinity or algal density.

Comparative analysis of YidC from D. shibae with homologs from non-marine bacteria could reveal adaptation signatures that provide insights into the evolution of membrane protein biogenesis in marine ecosystems.

What experimental challenges arise when studying YidC from non-model marine bacteria?

Investigating membrane proteins like YidC from non-model organisms such as D. shibae presents several unique challenges:

  • Expression optimization: While E. coli has been successfully used to express recombinant D. shibae YidC , optimal expression may require testing different expression systems, tags, and growth conditions.

  • Functional assays: Developing appropriate functional assays for YidC activity that reflect its native environment and substrate specificity requires careful consideration.

  • Structural studies: Membrane proteins are notoriously challenging for structural biology. For D. shibae YidC, researchers must optimize conditions for techniques like cryo-EM that have proven successful for homologous proteins .

  • Physiological relevance: Connecting in vitro findings to D. shibae's complex ecological interactions requires complementary in vivo approaches and careful interpretation.

  • Native substrate identification: Determining the specific membrane proteins that depend on D. shibae YidC for insertion represents a significant challenge but is crucial for understanding its biological role.

How does YidC function compare between marine and terrestrial bacteria?

Comparative analysis of YidC from marine bacteria like D. shibae with well-studied homologs from model organisms like E. coli can reveal important insights:

  • Substrate specificity: Marine bacteria may have membrane proteins with unique adaptations to marine environments, potentially requiring specialized features in their YidC insertases.

  • Structural adaptations: While the basic dimeric structure observed in E. coli YidC is likely conserved, specific structural features may be adapted to the marine bacterial membrane environment.

  • Regulatory mechanisms: The regulation of YidC activity or expression might differ in marine bacteria in response to their specific environmental challenges.

  • Integration with other membrane protein biogenesis pathways: The relationship between YidC and other protein translocation systems (such as Sec or Tat) might show marine-specific adaptations.

Experimental approaches to investigate these differences would include comparative biochemical characterization, substrate profiling, and structural analysis.

What can we learn from comparing YidC/Oxa1/Alb3 family members across domains of life?

The YidC/Oxa1/Alb3 family spans bacteria (YidC), mitochondria (Oxa1), and chloroplasts (Alb3), representing a conserved mechanism for membrane protein biogenesis across diverse cellular compartments .

Comparative analysis reveals:

  • Structural conservation: The formation of dimeric insertion pores appears to be a conserved feature, as demonstrated by studies of both E. coli YidC and S. cerevisiae Oxa1 .

  • Ribosome interaction: Both YidC and Oxa1 interact with the ribosome at similar sites (ribosomal protein L23 and rRNA helices 59 and 24), despite the evolutionary distance between bacteria and eukaryotes .

  • Functional diversification: Despite their structural similarities, these proteins have evolved specialized functions in their respective cellular contexts.

  • Integration with other cellular machineries: The ways in which these insertases coordinate with other cellular systems may differ across domains of life.

These comparisons highlight fundamental principles of membrane protein biogenesis that have been conserved throughout evolution while also revealing domain-specific adaptations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.