Recombinant Dinoroseobacter shibae Undecaprenyl-diphosphatase (uppP)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
uppP; Dshi_3593; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-267
Protein Length
full length protein
Species
Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Target Names
uppP
Target Protein Sequence
MTLFHLILVAVIQGLTEFLPVSSSGHLILLPELSGMADQGQVIDVAVHVGTLFAVVLYFR ADVAVAVAGVGRLIRGRIDTPGAFLALCLLIATVPVMVVGLALNLTGLDQALRSMAVIGW TMLIFGIVLYWADQRGPVTRKAGAWTLRHAAIMGLWQALALIPGTSRSGITITGARLLGY GREDAAKLSMLMSIPTILASGGLLGVEVAAQADWALLKDAAIGAVFAFGAALLALTLMMR LLRTVSFTPYVIYRVCLGTILLIIAYS
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of uppP in Dinoroseobacter shibae?

The uppP gene in D. shibae is likely not located within the photosynthetic gene cluster (PGC), which comprises more than 40 genes encoding enzymes for bacteriochlorophyll a and carotenoid biosynthesis, as well as structural proteins and transcriptional regulators . Instead, uppP is expected to be part of the core genome involved in cell wall synthesis. The PGC in D. shibae is known to be regulated by several proteins including PpsR (a repressor), PpaA (an antirepressor), and a blue light-dependent LOV-protein (Dshi_1135) . Unlike these light-regulated genes, uppP expression is likely constitutive due to its essential role in peptidoglycan synthesis.

How does D. shibae cell division relate to undecaprenyl phosphate recycling?

D. shibae exhibits interesting cell division characteristics, with time-lapse microscopy showing multiple outer membrane vesicle (OMV) production occurring at the septum during cell division . The peptidoglycan layer undergoes significant remodeling during cell division, requiring active undecaprenyl phosphate recycling by UppP. Some of the most abundant vesicle membrane proteins in D. shibae are predicted to interact directly with peptidoglycan during cell division (including LysM, Tol-Pal, Spol, and lytic murein transglycosylase) . This suggests a potential relationship between undecaprenyl phosphate recycling by UppP and the cell division process in this organism.

What expression systems are suitable for recombinant D. shibae UppP?

Based on successful genetic transformation methods developed for Roseobacter clade bacteria, several expression systems could be suitable for recombinant D. shibae UppP:

Expression SystemAdvantagesConsiderations
Native D. shibaeAuthentic post-translational modificationsLower yield; requires optimization
E. coli BL21(DE3)High yield; established protocolsMay require codon optimization
Other Roseobacter hostsSimilar cellular environmentValidated genetic tools available

For Roseobacter clade bacteria including D. shibae, conjugation and electroporation methods have been developed for efficient and stable genetic transformation . These methods, along with identified antibiotic resistance markers and stably maintained plasmids, provide a foundation for expressing recombinant proteins in these organisms.

How might the photoheterotrophic lifestyle of D. shibae affect UppP activity?

Dinoroseobacter shibae is a photoheterotrophic member of the Roseobacter group capable of performing aerobic anoxygenic photosynthesis (AAP) . While UppP primarily functions in cell wall biosynthesis rather than photosynthesis, its activity may be indirectly influenced by light conditions:

  • Gene expression of the photosynthetic gene cluster in D. shibae is regulated by several proteins including PpsR (repressor), PpaA (antirepressor), and the LOV-protein Dshi_1135, which respond to light conditions .

  • Under blue light conditions, the D. shibae wild type strain shows significantly different expression patterns of photosynthetic genes compared to dark conditions .

  • These light-dependent metabolic shifts could potentially alter membrane composition or cellular energy status, which might indirectly affect UppP activity or expression.

Experimental approach: Compare uppP expression levels and enzyme activity in D. shibae cultures grown under dark, white light, and blue light conditions using qRT-PCR and phosphatase activity assays.

What is the relationship between UppP and outer membrane vesicle formation in D. shibae?

D. shibae constitutively secretes DNA-containing outer membrane vesicles (OMVs) during normal growth, particularly during cell division . Several lines of evidence suggest a potential relationship between UppP activity and OMV formation:

  • UppP's role in undecaprenyl phosphate recycling is critical for peptidoglycan synthesis, which undergoes substantial remodeling during cell division.

  • OMV formation in D. shibae occurs particularly at the septum during cell division, coinciding with sites of active peptidoglycan synthesis .

  • D. shibae OMVs are enriched with proteins that interact with peptidoglycan during cell division, suggesting that cell wall remodeling and OMV formation are connected processes .

  • The FtsK-dif-XerC/XerD molecular machinery implicated in OMV DNA content in D. shibae operates at the last stage of cell division immediately prior to septum formation .

Research approach: Develop conditional uppP expression strains to examine how altered UppP activity affects OMV production, timing, and cargo content.

How does D. shibae UppP compare to similar enzymes in other Roseobacter clade bacteria?

UppP enzymes across the Roseobacter clade likely share significant homology while exhibiting species-specific adaptations:

SpeciesNotable CharacteristicsPotential UppP Adaptations
D. shibaePhotoheterotrophic; dinoflagellate symbiontMay have light-responsive regulation; role in OMV formation
R. denitrificansPhototroph; no undecaprenyl carrier lipid detectedDifferent substrate preference compared to D. shibae
O. indolifexNon-photosynthetic memberLikely different regulatory mechanisms
P. gallaeciensisNon-photosynthetic memberMay have different membrane composition affecting activity

While R. denitrificans did not show formation of ZE-mixed undecaprenyl diphosphate (a bacterial sugar-carrier lipid) in cell extracts , D. shibae may differ in this regard given its unique ecological niche as a dinoflagellate symbiont.

What role might UppP play in the symbiotic relationship between D. shibae and dinoflagellates?

D. shibae forms a symbiotic relationship with dinoflagellates, serving as a source of essential nutrients. UppP may influence this relationship through several mechanisms:

  • Cell Surface Integrity: UppP's role in maintaining proper cell wall structure may be important for recognition by and attachment to the dinoflagellate host.

  • OMV Production: Since D. shibae secretes DNA-containing OMVs , and UppP activity may influence OMV formation, UppP could indirectly affect the transfer of genetic material or signaling molecules to the host.

  • Adaptation to Host Environment: The cell envelope serves as the interface between D. shibae and its host environment, with UppP playing a key role in its maintenance and adaptation.

How can site-specific mutagenesis of UppP inform our understanding of its mechanism?

Site-directed mutagenesis of conserved residues in D. shibae UppP can provide valuable insights into its catalytic mechanism:

Target Residue TypeExpected Effect of MutationExperimental Readout
Catalytic siteDecreased enzymatic activityReduced phosphatase activity
Membrane interfaceAltered membrane associationChanged detergent requirements
Substrate binding pocketModified substrate specificityAltered kinetic parameters

The development of genetic tools for Roseobacter clade bacteria, including methods for chromosomal gene knockout as demonstrated with the dnr gene in D. shibae , provides a foundation for such mutagenesis studies.

What is the potential impact of UppP inhibitors on D. shibae's photosynthetic apparatus?

Inhibition of UppP would primarily affect peptidoglycan synthesis, but could indirectly impact photosynthetic capabilities:

  • Cellular stress from compromised cell wall integrity might trigger downregulation of non-essential processes, including photosynthesis.

  • Altered membrane structure due to peptidoglycan defects could disrupt the organization and function of photosynthetic complexes.

  • UppP inhibition might influence the PpsR-PpaA regulatory system, which controls photosynthetic gene expression in D. shibae . The D. shibae ppsR::Tn mutant strain shows very strong expression of photosynthetic genes under both dark and light conditions , suggesting complex regulatory interconnections.

What are the optimal conditions for expressing and purifying active recombinant D. shibae UppP?

For optimal expression and purification of active recombinant D. shibae UppP:

ParameterRecommended ConditionRationale
Expression hostD. shibae or E. coli with rare codon supplementationNative folding environment or high yield
Temperature20-25°CPrevents inclusion body formation
DetergentTriton X-100 (0.1-1%)Required for activity of related prenyltransferases
Purification methodMetal affinity chromatography with His-tagEfficient single-step purification
Buffer compositionInclude glycerol and reducing agentStabilizes membrane protein

The finding that a prenyltransferase from Paracoccus denitrificans required detergent such as Triton X-100 for catalytic activity suggests that D. shibae UppP may have similar requirements as a membrane-associated enzyme.

What analytical methods are most appropriate for characterizing D. shibae UppP activity?

Several complementary approaches can be used to characterize UppP activity:

  • Phosphatase Activity Assays:

    • Colorimetric assays to measure released phosphate

    • Radiometric assays using labeled substrates

    • HPLC-based methods to separate reaction products

  • Substrate Specificity Analysis:

    • Testing activity with various isoprenoid pyrophosphates of different chain lengths

    • Comparison with synthetic substrate analogs

  • Kinetic Characterization:

    • Determination of KM and Vmax under varying conditions

    • Analysis of pH and temperature optima

    • Effect of divalent cations and potential inhibitors

How can recombinant D. shibae UppP contribute to understanding bacterial cell wall synthesis regulation?

Recombinant D. shibae UppP can serve as a model for studying the regulation of peptidoglycan synthesis in photoheterotrophic marine bacteria:

  • Light-dependent regulation: Investigate whether UppP activity varies under different light conditions that affect the bacterium's photosynthetic activity.

  • Cell cycle coordination: Examine how UppP activity is coordinated with the FtsK-dif-XerC/XerD molecular machinery that operates during the final stages of cell division .

  • Membrane vesicle formation: Study how UppP activity relates to outer membrane vesicle production, which occurs at the septum during cell division in D. shibae .

  • Comparative analysis: Compare the regulatory properties of UppP across different Roseobacter clade bacteria, including phototrophs (D. shibae, R. denitrificans) and non-phototrophs (O. indolifex, P. gallaeciensis) .

What are promising research directions for D. shibae UppP studies?

Future research on D. shibae UppP could explore:

  • The potential connection between light-dependent metabolism and UppP activity, given D. shibae's photoheterotrophic lifestyle.

  • The role of UppP in outer membrane vesicle formation, which occurs prominently at the septum during cell division.

  • How UppP activity impacts the symbiotic relationship between D. shibae and dinoflagellates.

  • Comparative analysis of UppP structure and function across the Roseobacter clade to identify adaptations related to different ecological niches.

  • Potential interactions between UppP and the site-specific recombinases XerC/XerD, which are activated during cell division and may influence DNA content in outer membrane vesicles .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.