Recombinant Dioscorea elephantipes Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVRIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEVKEKMGNLSFQNYRPNKKNIIVIGPAPG QKYSEIVFPILSPDPATKKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSAGIVS KIVRKEKGGYEITIIDASDGHQVVDIIPRGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRIQGLLFFLASVILAQIFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function

Recombinant Dioscorea elephantipes Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.

Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Recombinant Dioscorea elephantipes Apocytochrome f (petA)?

Recombinant Dioscorea elephantipes Apocytochrome f is a protein encoded by the petA gene, corresponding to amino acids 36-320 of the mature protein (UniProt ID: A6MMM0). This recombinant protein is typically produced with an N-terminal His-tag fusion in bacterial expression systems, predominantly E. coli . The protein represents the functional domain of cytochrome f, an essential component of the photosynthetic electron transport chain found in the chloroplasts of Dioscorea elephantipes (Elephant's foot yam), a species native to South Africa3 .

What are the standard storage and reconstitution conditions for the recombinant protein?

The lyophilized recombinant protein requires specific handling to maintain stability and activity:

ParameterRecommended Condition
Storage Temperature-20°C to -80°C
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water (0.1-1.0 mg/mL)
Long-term StorageAdd 5-50% glycerol (final concentration) and aliquot
Stability ConsiderationsAvoid repeated freeze-thaw cycles

For optimal results, centrifuge the vial briefly before opening, and store working aliquots at 4°C for up to one week . The addition of glycerol (typically 50% final concentration) significantly improves long-term stability during frozen storage.

What expression systems are most effective for recombinant Apocytochrome f production?

While E. coli remains the predominant expression system for recombinant Apocytochrome f from D. elephantipes, the methodology can be adapted from established protocols for other cytochrome f proteins:

  • Bacterial Expression (E. coli): The most widely used approach involves cloning the petA gene fragment into expression vectors such as pTrc99A with appropriate restriction sites (e.g., NcoI/HindIII) . This system typically requires:

    • Incorporation of an ATG start codon for the mature protein

    • Optimization of codon usage for bacterial expression

    • Induction with IPTG (typically 1 mM) at moderate temperatures (30°C)

    • Growth to mid-log phase (A600 = 0.6) before induction

  • Plant-Based Expression: While less common for D. elephantipes proteins, plant-based systems may provide more authentic post-translational modifications but with lower yields.

  • Insect Cell Systems: These can be utilized for complex proteins requiring eukaryotic processing machinery.

The selection of expression system should be guided by the intended experimental application, with bacterial systems offering high yield but potential limitations in post-translational modifications.

What are the critical optimization parameters for expressing functional Apocytochrome f in E. coli?

Several critical parameters must be optimized when expressing D. elephantipes Apocytochrome f in E. coli:

ParameterOptimization ApproachRationale
TemperatureReduce to 16-30°C post-inductionMinimizes inclusion body formation
Induction TimingInduce at mid-log phase (OD600 ~0.6)Balances biomass with expression capacity
IPTG ConcentrationTitrate between 0.1-1.0 mMHigher is not always better; can increase toxicity
Media CompositionConsider auto-induction mediaProvides controlled expression without monitoring
Host StrainBL21(DE3) or derivativesLacks proteases, contains T7 polymerase
Codon OptimizationAdapt rare codons for E. coli usagePrevents translation stalling and truncation

For Apocytochrome f specifically, incorporation of the mature protein sequence (residues 36-320) rather than the full-length sequence improves expression by eliminating the hydrophobic thylakoid targeting sequence that can complicate bacterial expression .

How does D. elephantipes Apocytochrome f compare with other Dioscorea species?

Dioscorea elephantipes belongs to the Stenophora clade, one of the most basal lineages in Dioscorea evolution. Metabolite profiling studies have shown that:

  • D. elephantipes clusters closely with D. sylvatica in biochemical profiling analyses

  • Species from the Stenophora clade (including D. elephantipes) appear to be a center of biochemical origin within the genus

  • Approximately 90% of basal Stenophora species are distributed in Asia, despite D. elephantipes being native to South Africa

This taxonomic positioning makes D. elephantipes Apocytochrome f particularly interesting for comparative studies of photosynthetic proteins across evolutionary lineages. The conservation of cytochrome f structure across diverse plant species reflects its essential role in electron transport, while species-specific variations may provide insights into adaptive evolution of photosynthesis.

What insights can metabolite profiling provide about D. elephantipes biochemistry?

Metabolite profiling of D. elephantipes has revealed several distinctive biochemical features:

  • High abundance of shikimic acid in stem and leaf material, suggesting potential for bioprospecting applications

  • Comprehensive GC-MS analysis has identified 535 metabolic features across different plant structures (stem, leaf, root, inner and outer parts of caudiciform tuber)

  • A core set of 38 metabolites can reliably discriminate between different regions of the plant

These metabolomic insights provide context for understanding the cellular environment in which Apocytochrome f functions within D. elephantipes, potentially informing studies on protein-metabolite interactions and regulation of photosynthetic proteins.

What structural analysis techniques are most informative for recombinant Apocytochrome f studies?

Multiple complementary structural biology approaches can be employed to characterize recombinant D. elephantipes Apocytochrome f:

For functional characterization, techniques such as absorption spectroscopy (particularly at wavelengths characteristic of heme proteins) can provide insights into the cofactor environment and redox properties.

How can recombinant Apocytochrome f be used to study photosynthetic electron transport?

Recombinant D. elephantipes Apocytochrome f enables several experimental approaches to investigate photosynthetic electron transport:

  • Reconstitution Experiments: Incorporating the recombinant protein into liposomes with other components of the electron transport chain to measure electron transfer rates

  • Interaction Studies: Using techniques such as surface plasmon resonance (SPR), isothermal titration calorimetry (ITC), or co-immunoprecipitation to characterize interactions with plastocyanin and other partner proteins

  • Mutational Analysis: Creating site-directed mutants to probe the role of specific residues in electron transfer, protein-protein interactions, or structural stability

  • Comparative Studies: Analyzing functional differences between Apocytochrome f from D. elephantipes and other plant species to identify evolutionary adaptations in photosynthetic machinery

These approaches can provide insights into fundamental aspects of photosynthesis as well as potential applications in synthetic biology and bioenergy research.

What are common issues in recombinant Apocytochrome f purification and how can they be addressed?

ChallengePossible CausesSolution Strategies
Low Protein YieldPoor expression, protein degradation, inefficient extractionOptimize induction conditions; add protease inhibitors; use stronger lysis methods
Poor SolubilityImproper folding, aggregationLower induction temperature (16-20°C); add solubility tags; use specialized host strains
Low PurityNon-specific binding to purification matrixIncrease imidazole in wash buffers; add second purification step (e.g., ion exchange, size exclusion)
Inactive ProteinImproper folding, cofactor absenceConsider refolding protocols; add heme precursors to growth media
Precipitation After PurificationBuffer incompatibility, high concentrationScreen stabilizing additives (glycerol, trehalose); adjust pH and ionic strength

For recombinant D. elephantipes Apocytochrome f specifically, maintaining proper storage conditions is critical, with lyophilized protein being more stable than solutions for long-term storage .

How can researchers validate the structural integrity of purified recombinant Apocytochrome f?

Validation of structural integrity should employ multiple complementary approaches:

  • SDS-PAGE: Confirms expected molecular weight and initial purity assessment (>90% purity is typically desired)

  • Western Blotting: Confirms identity using anti-His tag or specific anti-cytochrome f antibodies

  • Size Exclusion Chromatography: Assesses aggregation state and homogeneity

  • Spectroscopic Analysis: Characteristic absorption spectra for properly folded heme-containing proteins:

    • Soret band (~400-420 nm)

    • Q bands (500-600 nm)

    • Distinctive spectral shifts upon reduction/oxidation

  • Functional Assays: Electron transfer capability or binding to known interaction partners

These validation steps are essential before proceeding to more complex structural or functional studies to ensure that experimental results accurately reflect the native properties of the protein.

What emerging technologies could advance research on D. elephantipes Apocytochrome f?

Several cutting-edge approaches show promise for advancing understanding of Apocytochrome f structure and function:

  • Cryo-Electron Microscopy (Cryo-EM): Enables visualization of protein complexes without crystallization, potentially revealing dynamic aspects of cytochrome f interactions within the photosynthetic machinery

  • Single-Molecule Techniques: Including single-molecule FRET to track conformational changes during electron transfer events

  • Computational Approaches: Molecular dynamics simulations and quantum mechanical calculations to model electron transfer processes with atomic detail

  • Synthetic Biology: Engineering optimized variants with enhanced stability or electron transfer properties for biotechnological applications

  • In-Cell NMR: Examining protein behavior in cellular environments rather than purified systems

Integration of these technologies with traditional biochemical approaches will provide more comprehensive understanding of Apocytochrome f biology and its role in photosynthesis.

How might comparative studies across Dioscorea species inform evolutionary adaptations in photosynthetic machinery?

Comparative analysis of Apocytochrome f across the Dioscorea genus offers unique insights into evolutionary adaptations:

  • D. elephantipes belongs to the basal Stenophora clade, making it valuable for understanding ancestral photosynthetic mechanisms

  • The genus inhabits diverse ecological niches spanning multiple continents, potentially driving adaptations in photosynthetic efficiency

  • Recent metabolomic studies have demonstrated that biochemical profiles cluster according to phylogenetic relationships, suggesting coordinated evolution of metabolic networks

  • Species-specific adaptations in cytochrome f may correlate with environmental factors such as light intensity, temperature ranges, or water availability

Such comparative approaches could reveal how photosynthetic electron transport has evolved in response to environmental pressures, potentially informing strategies for crop improvement or engineering photosynthesis for changing climate conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.