Recombinant Dioscorea elephantipes ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock
Cat. No.
BT2142343
Source
in vitro E.coli expression system
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Quick Inquiry

Description

Role in ATP Synthase Function

ATP synthase is a multi-subunit complex comprising F<sub>O</sub> (membrane-embedded) and F<sub>1</sub> (catalytic) domains. Subunit a (atpI) is part of the F<sub>O</sub> sector and facilitates proton translocation across the thylakoid membrane . Key interactions include:

  • Stator Stalk Assembly: In chloroplasts, subunit a anchors the peripheral stator stalk (composed of subunits b and δ) to F<sub>O</sub>, ensuring torque transmission during ATP synthesis .

  • Proton Channel Formation: Collaborates with the c-ring to create a pathway for protons, driving rotational catalysis .

Research Applications

The recombinant protein is utilized in:

  1. Enzyme Mechanism Studies: Investigating proton-driven ATP synthesis/hydrolysis in chloroplasts .

  2. Structural Biology: Cryo-EM and X-ray crystallography to resolve stator stalk architecture .

  3. Protein Interaction Mapping: Identifying binding partners (e.g., subunits b, δ) via pull-down assays .

Biochemical Properties

  • Stability: Retains activity in pH 7.4 buffers with 20% glycerol .

  • Redox Sensitivity: Unlike mitochondrial ATP synthase, chloroplast variants (including atpI) are regulated by thioredoxin-mediated disulfide bonding in the γ-subunit .

  • Conservation: The atpI sequence is highly conserved across Dioscorea species, with 99% identity in coding regions .

Comparative Genomics

A sliding window analysis of 24 Dioscorea chloroplast genomes revealed:

  • Low Variability: atpI exhibits minimal nucleotide diversity (π < 0.005), indicating strong functional constraints .

  • SSR Content: The gene lacks simple sequence repeats (SSRs), unlike hypervariable regions like ycf1 or rpl32 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we currently have in stock. However, if you have specific format requirements, please include them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution. Store at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life depends on multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
atpI
Target Protein Sequence
MNVIPCSIKTLKGLYDISGVEVGQHLYWQIGALQIHAQVLITSWVVIAILLGSVIIAVRN PQTIPSGGQNFFEYVLEFIRDLSKAQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII QLPHGELAAPTNDINTTVALALPTSVAYFYAGLTKKGLGYFRKYIQPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPSLVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.
A6MMJ5

Target Background

Function
ATP synthase subunit a is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.