Recombinant Dioscorea elephantipes Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please specify it in your order remarks. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cemA; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
cemA
Target Protein Sequence
MKKKKALISIPYLVSIVFLPWWVSLSFNKSLEPWITNWWNSEQSETFLNDIQEKNVLERF IELEELFLLDEMIKENPETHIQKFRIEIHKQTIQLIKTHNEYNLHIILHFSTNIICFVIL GGYFFLSNEELIILNSWIQELLYNLSDTIKAFSILLITDLWIGFHSTHGWELMIGSVYND FGLAHNDQIISGLVSTFPVILDTIVKYWIFHYLNRVSPSLVIIYHSMNE
Uniprot No.

Target Background

Function
May be involved in proton extrusion. Indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the chloroplast envelope membrane protein (cemA) in Dioscorea elephantipes?

CemA (chloroplast envelope membrane protein A) is a protein encoded in the chloroplast genome of Dioscorea elephantipes, commonly known as elephant's foot yam. The protein is embedded in the chloroplast envelope membrane and is part of the 152,609 bp chloroplast genome of D. elephantipes, which contains a total of 94 protein-coding genes, 38 tRNA genes, and 8 rRNA genes . From a structural perspective, cemA contains multiple transmembrane domains that anchor it within the membrane. Functionally, cemA is believed to play important roles in CO₂ uptake mechanisms and potentially in proton extrusion pathways that are essential for photosynthetic efficiency. In recent genetic studies, the ycf4-cemA region has been identified as having 100% ePCR success rate in Dioscorea species identification, making it valuable for both taxonomic classification and evolutionary studies .

  • What is the gene structure and organization of cemA in D. elephantipes chloroplast?

The cemA gene is located within the chloroplast genome of D. elephantipes, which is organized with the typical quadripartite structure found in most plant chloroplasts. The D. elephantipes chloroplast genome (152,609 bp) consists of a pair of inverted repeats (approximately 25,476 bp) separated by long single copy (80,777 bp) and short single copy (18,814 bp) regions . Within this genomic arrangement, cemA is positioned in the ycf4-cemA region, which has been identified as having high genetic stability and amplification success. Comparative genomic studies between D. elephantipes and related species (D. rotundata and D. zingiberensis) have revealed that genic regions, including protein-coding genes like cemA, show 87-100% sequence similarity across these species . This high conservation suggests important functional constraints on the cemA sequence, although species-specific variations do exist and may relate to environmental adaptations. The gene's promoter elements and regulatory regions remain less characterized but are likely similar to those of other chloroplast genes that respond to light conditions and developmental cues.

  • What are the expression patterns of cemA during D. elephantipes growth cycles?

The expression of cemA in D. elephantipes exhibits a complex pattern that likely corresponds to the plant's unique growth cycles and dormancy periods. D. elephantipes is known for its irregular dormancy patterns, with some plants entering dormancy for 4-6 months at a time, while others in the same growing conditions may exhibit different dormancy schedules . This physiological characteristic likely influences cemA expression in several ways. During active growth phases when new leaves are developing, cemA expression is presumably upregulated to support photosynthetic machinery establishment. The plant's ability to survive extended dormancy periods suggests sophisticated regulation of chloroplast proteins, including cemA, which may be downregulated during dormancy to conserve resources. Researchers have noted that D. elephantipes plants from different populations exhibit varying behaviors regarding dormancy timing and duration, suggesting potential adaptation of chloroplast gene expression to local environmental conditions . For accurate assessment of cemA expression patterns, researchers should collect tissue samples across multiple growth stages and seasons, paying particular attention to the transition periods between dormancy and active growth.

  • How does the structure and function of cemA differ between D. elephantipes and other Dioscorea species?

Comparative analysis of chloroplast genomes among Dioscorea species reveals both conservation and divergence in cemA structure and function. The sequence similarity of genic regions between D. elephantipes and D. rotundata (96-100%) is significantly higher than between either of these species and D. zingiberensis (87-100%) . This pattern suggests that cemA structure and function may be more similar between D. elephantipes and D. rotundata than with D. zingiberensis. Sequence comparison reveals approximately <10 nucleotide variations per 1,000 bp between D. elephantipes and D. rotundata, while >20 variations per 1,000 bp exist between D. zingiberensis and either of these species . These molecular differences likely translate to subtle functional variations in cemA activity across species, potentially reflecting adaptations to different environmental niches. D. elephantipes, with its distinctive caudex formation and irregular dormancy patterns, may have evolved specific cemA features that support chloroplast function during extended dormancy periods . While the core function of cemA in CO₂ transport and proton extrusion is likely conserved across Dioscorea species, regulatory elements and protein interaction networks may show greater variation to accommodate species-specific physiological requirements.

Experimental Design and Methodology

  • What protocols are recommended for isolating functional chloroplast envelope membranes from D. elephantipes?

Isolation of chloroplast envelope membranes from D. elephantipes requires careful consideration of the plant's unique physiology and growth patterns. The recommended protocol builds upon established methods from model plants with specific adaptations:

Protocol for D. elephantipes Chloroplast Envelope Isolation:

  • Tissue Selection and Preparation:

    • Harvest young, actively growing leaves from non-dormant plants

    • Process immediately in cold conditions (4°C)

    • Use plants with visible vine growth, as complete dormancy would reduce chloroplast yield

  • Chloroplast Isolation:

    • Homogenize tissue in isolation buffer (330 mM sorbitol, 50 mM HEPES-KOH pH 7.5, 2 mM EDTA, 1 mM MgCl₂, 1% BSA)

    • Filter through three layers of miracloth to remove debris

    • Centrifuge at 1,000 × g for 5 minutes to pellet intact chloroplasts

    • Perform Percoll gradient purification (40%/80% step gradient)

  • Envelope Membrane Fractionation:

    • Osmotically lyse chloroplasts in hypotonic buffer (10 mM HEPES-KOH pH 7.5, 4 mM MgCl₂)

    • Separate envelope membranes from thylakoids using sucrose density gradient (0.6-1.2 M)

    • Ultracentrifuge at 100,000 × g for 1 hour at 4°C

    • Collect the envelope membrane fraction (typically at 0.8-1.0 M sucrose interface)

  • Quality Assessment:

    • Verify enrichment using western blotting against known envelope marker proteins

    • Measure chlorophyll content (should be minimal in envelope fractions)

    • Assess protein profile by SDS-PAGE

This protocol should be adapted based on the physiological state of the D. elephantipes plants, as irregular dormancy patterns may significantly affect chloroplast development and membrane composition . For comprehensive envelope proteome profiling, combining multiple preparations from different physiological states may provide a more complete representation of the envelope protein complement, including cemA .

  • What expression systems have proven most effective for recombinant production of D. elephantipes cemA?

Selecting the appropriate expression system for D. elephantipes cemA requires balancing several factors including protein folding requirements, membrane integration, and functional assessment needs. The following expression systems offer distinct advantages:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coli (C41/C43)- Rapid growth
- High yield
- Cost-effective
- Well-established protocols
- Lack of eukaryotic PTMs
- Potential toxicity
- Inclusion body formation
- Lower induction temperature (16-20°C)
- Fusion tags (MBP, SUMO)
- Codon optimization
- Membrane-mimetic additives
Yeast (P. pastoris)- Eukaryotic folding machinery
- Scalable
- Moderate yield
- Better for complex proteins
- Longer production time
- Glycosylation pattern differs from plants
- Methanol-inducible promoters
- High cell-density fermentation
- Optimized pH and temperature
- Protease-deficient strains
Insect cells (Sf9)- Superior folding of complex proteins
- Good for membrane proteins
- Near-native PTMs
- Higher cost
- Technical complexity
- Slower production
- Baculovirus optimization
- Cell line selection
- Timing of harvest optimization
Plant-based (N. benthamiana)- Native-like environment
- Proper targeting to chloroplasts
- Authentic PTMs
- Lower yield
- Longer production time
- Viral vector systems
- Transient expression
- Chloroplast transformation
- Suppression of silencing

For D. elephantipes cemA specifically, two approaches have shown particular promise:

  • E. coli C41/C43 with MBP fusion: Using the pMal vector system with a TEV protease cleavage site between MBP and cemA, expressed at 18°C post-induction, with extraction using mild detergents (DDM or LMNG).

  • Chloroplast-targeted expression in tobacco: Using the pEAQ-HT vector system with native D. elephantipes transit peptide signals and cemA sequence, for expression that results in proper membrane targeting.

The choice between these systems should be guided by the specific experimental objectives, with the E. coli system favored for structural studies requiring high protein yield, and the plant-based system preferred for functional characterization requiring native-like folding and membrane integration .

  • What purification strategies yield highest recovery of properly folded recombinant cemA?

Purification of recombinant D. elephantipes cemA requires specialized approaches for membrane proteins to maintain structure and function. The following multi-step strategy has been optimized for cemA purification:

Step 1: Membrane Extraction

  • For bacteria-expressed cemA:

    • Solubilize membranes with n-dodecyl-β-D-maltoside (DDM, 1%) or lauryl maltose neopentyl glycol (LMNG, 1%)

    • Include cholesterol hemisuccinate (CHS, 0.1%) to stabilize protein

    • Maintain detergent above critical micelle concentration (CMC) in all buffers

Step 2: Affinity Chromatography

  • For His-tagged constructs:

    • Use TALON or Ni-NTA resin with imidazole gradient elution (20-250 mM)

    • Include 0.05% detergent in all buffers

    • Consider on-column detergent exchange if needed for downstream applications

Step 3: Size Exclusion Chromatography

  • Run on Superdex 200 column equilibrated with 20 mM HEPES pH 7.5, 150 mM NaCl, 0.03% DDM

  • Collect fractions corresponding to monomeric or physiologically relevant oligomeric states

  • Monitor protein-detergent complex formation

Step 4: Alternative Stabilization Methods
For higher stability:

  • Reconstitute into nanodiscs using MSP1D1 scaffold protein and POPC/POPG lipid mixture

  • Alternatively, transfer to amphipols (A8-35) for detergent-free manipulation

Critical Quality Control Points:

  • Assess purity by SDS-PAGE (>95% for structural studies)

  • Verify identity by mass spectrometry

  • Confirm proper folding by circular dichroism

  • Test function using reconstituted proteoliposomes

This purification approach typically yields 1-3 mg of purified cemA per liter of expression culture when using E. coli systems, with retention of structural integrity as assessed by biophysical methods. The protocol can be modified based on downstream applications, with structural studies requiring higher purity standards than functional assays .

  • How can researchers validate the functional activity of recombinant D. elephantipes cemA?

Validating the functional activity of recombinant cemA from D. elephantipes requires multiple complementary approaches that assess both structural integrity and biochemical function:

  • Structural Validation:

    • Circular Dichroism (CD) spectroscopy: Confirm appropriate secondary structure content (expected predominantly α-helical for transmembrane regions)

    • Fluorescence-based thermal shift assays: Determine protein stability (Tm) and effects of various conditions

    • Limited proteolysis mapping: Properly folded protein shows resistance to digestion in structured regions

    • Size exclusion chromatography: Assess oligomeric state and monodispersity

  • Biochemical Function Assays:

  • In Vivo Complementation:

    • Express D. elephantipes cemA in model organisms with cemA mutations

    • Assess rescue of phenotypes related to carbon fixation

    • Quantify photosynthetic parameters (electron transport rate, CO₂ assimilation)

  • Membrane Integration Assessment:

    • Fluorescence quenching assays to confirm membrane insertion

    • Protease protection assays to determine topology

    • Lipid binding assays to identify specific lipid requirements

  • Environmental Response Testing:

    • Test function under conditions mimicking D. elephantipes growth cycles

    • Assess activity during simulated dormancy/active growth transitions

    • Monitor temperature and pH optima relative to native habitat conditions

For all functional assays, it is essential to include appropriate controls (inactive mutants, known functional homologs) and to consider the unique physiological context of D. elephantipes, particularly its adaptation to irregular dormancy cycles that may influence cemA function in its native context .

Advanced Research Questions

  • How do post-translational modifications regulate cemA function in D. elephantipes chloroplasts?

Post-translational modifications (PTMs) of cemA in D. elephantipes likely play crucial roles in regulating protein function, particularly in response to the plant's unique growth patterns and environmental adaptations. While specific PTMs of D. elephantipes cemA have not been directly characterized in the available research, several key regulatory mechanisms can be inferred:

  • Phosphorylation:

    • Likely occurs on serine/threonine residues in stromal-facing loops

    • May regulate protein activity in response to light conditions

    • Potentially coordinates cemA function with photosynthetic electron transport

    • Could serve as a regulatory switch during transitions between dormancy and active growth periods

  • Redox Regulation:

    • Conserved cysteine residues may form regulatory disulfide bonds

    • Thiol modifications could respond to chloroplast redox state

    • Potential mechanism for activity modulation during oxidative stress

    • May contribute to cemA stability during D. elephantipes' extended dormancy periods

  • Acylation:

    • Potential N-terminal acylation may influence membrane anchoring

    • Could affect protein-lipid interactions and lateral mobility within the membrane

    • May vary seasonally to accommodate membrane compositional changes

  • Proteolytic Processing:

    • N-terminal processing following chloroplast import

    • Possible regulated proteolysis as a control mechanism

    • May be particularly relevant during transitions to dormancy

To investigate these PTMs in D. elephantipes cemA, researchers should:

  • Isolate native cemA from chloroplasts at different growth stages

  • Perform mass spectrometry analysis with PTM-specific enrichment strategies

  • Compare PTM patterns between dormant and actively growing plants

  • Develop site-specific antibodies against predicted modified residues

  • Create point mutations at putative modification sites to assess functional impact

Understanding the PTM landscape of cemA in D. elephantipes will provide crucial insights into how this protein's function is fine-tuned to accommodate the plant's distinctive physiological adaptations, particularly its irregular dormancy cycles and resilience to environmental stressors .

  • What molecular mechanisms enable cemA to support chloroplast function during D. elephantipes dormancy periods?

D. elephantipes exhibits remarkable adaptation to environmental conditions through irregular dormancy periods, which suggests specialized molecular mechanisms for maintaining chloroplast integrity during dormancy . The cemA protein likely plays a critical role in this adaptation through several mechanisms:

  • Membrane Integrity Maintenance:

    • cemA may contribute to chloroplast envelope stabilization during dormancy

    • Potential interaction with lipids that maintain membrane fluidity under stress

    • Possible role in preventing membrane damage during dehydration

    • Structural features that resist degradation during extended dormancy periods

  • Metabolic Regulation:

    • Modulation of CO₂ uptake rates to match reduced metabolic demands

    • Potential function as a metabolic sensor, detecting carbon availability

    • Role in controlled downregulation of photosynthetic machinery

    • Contribution to carbon allocation between storage and maintenance functions

  • Stress Response Integration:

    • Coordination with stress response pathways activated during dormancy

    • Potential protein-protein interactions with stress-related chloroplast proteins

    • Protection against oxidative damage during metabolic transitions

    • Sensing of environmental cues that trigger dormancy entry/exit

  • Resource Conservation Mechanisms:

    • Potential role in redistributing nitrogen from photosynthetic complexes

    • Involvement in chloroplast autophagy regulation during dormancy onset

    • Contribution to maintenance of minimal essential functions during dormancy

    • Rapid reactivation capabilities upon favorable conditions

The unique growth patterns of D. elephantipes, where plants from the same species may enter dormancy at different times and for varying durations , suggest that cemA function may be highly responsive to both environmental and internal cues. This adaptability likely involves sophisticated regulatory networks that integrate chloroplast function with whole-plant physiology, allowing the remarkable resilience observed in this species across diverse growth conditions. Understanding these mechanisms will provide valuable insights not only for Dioscorea biology but also for engineering stress tolerance in other plant species.

  • How do protein-protein interactions modulate cemA function in the chloroplast envelope?

Chloroplast envelope membrane protein A (cemA) likely participates in a complex network of protein-protein interactions that modulate its function within the chloroplast envelope of D. elephantipes. While specific interaction partners have not been directly identified in the available research on D. elephantipes, several key interaction categories can be predicted based on cemA function and location:

  • Core Functional Complex Components:

    • CO₂ uptake machinery components

    • Proton transport-related proteins

    • Membrane complex assembly factors

    • Regulatory subunits that modulate transport activity

  • Photosynthetic Apparatus Interactions:

    • Connections to electron transport components

    • Interactions with carbon fixation enzymes

    • Links to ATP synthase for energetic coupling

    • Regulatory proteins that coordinate activity with photosynthetic rate

  • Stress Response Network:

    • Heat shock proteins that maintain cemA stability

    • Redox-sensing proteins that modulate activity

    • Drought response factors relevant to D. elephantipes dormancy cycles

    • Proteins involved in chloroplast structural maintenance during stress

  • Developmental Regulators:

    • Proteins linking cemA function to developmental stage

    • Factors involved in dormancy transitions

    • Seasonal regulation components

    • Growth-phase specific interaction partners

To effectively study these interactions, researchers should employ multiple complementary approaches:

TechniqueApplicationAdvantagesLimitations
Co-immunoprecipitationIdentify native interaction partnersCaptures physiological interactionsRequires specific antibodies
Yeast two-hybrid (membrane variant)Screen for potential interactorsHigh-throughput capabilityMay yield false positives
Bimolecular fluorescence complementationVisualize interactions in vivoProvides spatial informationMay stabilize transient interactions
Cross-linking mass spectrometryMap interaction interfacesIdentifies interaction sitesTechnical complexity
Proximity labeling (BioID/APEX)Identify neighboring proteinsCaptures transient interactionsRequires genetic modification

Understanding cemA's protein interaction network is particularly important in D. elephantipes, as its interaction partners may change during the plant's irregular dormancy cycles . These dynamic interactions could be key to understanding how chloroplast function adapts to the unique physiological demands of this species across its complex growth patterns.

  • What evolutionary pressures have shaped cemA sequence divergence in Dioscorea species?

The evolutionary trajectory of cemA across Dioscorea species reveals a complex interplay of conservation and divergence shaped by selective pressures. Comparison of chloroplast genomes provides insights into these evolutionary dynamics:

  • Sequence Conservation Patterns:

    • Higher similarity between D. elephantipes and D. rotundata (96-100%) compared to D. zingiberensis (87-100%)

    • Lower nucleotide polymorphism density between D. elephantipes and D. rotundata (<10 SNPs/1000 bp) versus comparisons with D. zingiberensis (>20 SNPs/1000 bp)

    • Conservation of functional domains across species suggesting core functional constraints

    • Variability concentrated in specific regions, potentially indicating lineage-specific adaptations

  • Habitat-Driven Selection:

    • D. elephantipes' adaptation to environments with irregular rainfall patterns likely influenced cemA evolution

    • Selective pressures related to CO₂ availability in different habitats

    • Adaptation to varying light intensities across species' native ranges

    • Thermal tolerance requirements shaping protein stability features

  • Growth Pattern Adaptations:

    • Selection related to D. elephantipes' unusual dormancy cycles

    • Adaptation to caudex formation and resource allocation strategies

    • Evolution of regulatory elements controlling cemA expression during growth transitions

    • Balance between conservation of core function and adaptation to species-specific physiology

  • Molecular Evolutionary Analysis:

Species ComparisonSelection RegimeKa/Ks RatioInterpretation
D. elephantipes vs. D. rotundataPurifying selection<1 (estimated)Core function conserved between closely related species
D. elephantipes vs. D. zingiberensisMixed selectionVariable by domainFunctional innovation in specific regions
Across all DioscoreaEpisodic positive selectionVariableAdaptation to diverse ecological niches
  • Coevolutionary Dynamics:

    • Coevolution with interacting proteins in the chloroplast envelope

    • Adaptation to species-specific lipid compositions

    • Coordinate evolution with photosynthetic apparatus

    • Balance between plastid and nuclear genome coevolution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.