Recombinant Dioscorea elephantipes NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ndhC; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWAFLIISSIIPILAFLISGVLTPIREGSEKLSSYESGIEPMGNAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGISVFIEAFIFVLIPIVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur (Fe-S) centers within the photosynthetic electron transport chain, and potentially within a chloroplast respiratory chain. In this species, the enzyme's primary electron acceptor is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of NAD(P)H-quinone oxidoreductase subunit 3 in Dioscorea elephantipes?

The chloroplastic NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) from Dioscorea elephantipes is a membrane protein that forms part of the chloroplast NDH complex. Based on comparative analyses with similar proteins, it contains approximately 120 amino acids with multiple transmembrane domains. The protein's structure includes hydrophobic regions that anchor it within the thylakoid membrane, with specific functional domains oriented toward either the stromal or lumenal side of the membrane. Analysis of its amino acid sequence reveals conserved regions that are essential for electron transfer and interaction with other subunits of the complex . The protein contains distinctive structural elements that facilitate quinone binding and reduction through interaction with the flavin cofactor (FAD).

How does the enzyme mechanism of NAD(P)H-quinone oxidoreductase work in chloroplasts?

The chloroplastic NAD(P)H-quinone oxidoreductase operates via a ping-pong Bi-Bi kinetic mechanism, similar to other NQO family members. In this mechanism:

  • The enzyme first binds NAD(P)H, which reduces the FAD cofactor to FADH₂

  • The oxidized NAD(P)⁺ is released from the binding site

  • A quinone substrate binds to the same binding pocket

  • The reduced FADH₂ transfers electrons to the quinone, reducing it to hydroquinone

  • The hydroquinone is released and the enzyme returns to its original state

This reaction involves significant conformational changes in the protein structure as demonstrated in studies of related enzymes. The binding site alternates between two conformational states to accommodate first the NAD(P)H and then the quinone substrate . Tyrosine residues and specific loops within the protein play critical roles in controlling access to the catalytic site, which is essential for the sequential binding of substrates and release of products .

What expression systems are most effective for producing recombinant D. elephantipes NQO subunit 3?

  • Codon optimization: Plant chloroplast proteins often contain codons rarely used in E. coli, necessitating codon optimization for the target sequence

  • Expression vectors: pET series vectors with T7 promoters provide high expression levels

  • Host strain selection: BL21(DE3) or Rosetta(DE3) strains are recommended, with the latter providing tRNAs for rare codons

  • Membrane protein challenges: As a membrane protein, expression often results in inclusion bodies, requiring:

    • Lower induction temperatures (16-20°C)

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Consider fusion tags like MBP that enhance solubility

For researchers seeking higher structural fidelity, eukaryotic expression systems such as insect cells (Sf9 or Hi5) using baculovirus expression vectors may yield properly folded protein with appropriate post-translational modifications .

What are the most efficient purification techniques for this recombinant protein?

Purification of recombinant D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3 requires a strategic approach due to its membrane-associated nature. A multi-step purification protocol is recommended:

  • Membrane preparation:

    • Cell lysis via sonication or French press in buffer containing 50 mM Tris-HCl (pH 7.5), 150 mM NaCl, and protease inhibitors

    • Differential centrifugation to isolate membrane fractions (100,000×g for 1 hour)

  • Solubilization:

    • Gentle detergents like n-dodecyl-β-D-maltoside (DDM, 1%) or digitonin (1-2%) in solubilization buffer

    • Incubation with gentle agitation for 2-3 hours at 4°C

  • Affinity chromatography:

    • If histidine-tagged, use Ni-NTA resin with stepwise imidazole elution (50-250 mM)

    • For other tags, appropriate affinity matrices should be employed

  • Size exclusion chromatography:

    • Final polishing step using Superdex 200 in buffer containing 0.05% DDM and 10% glycerol

Throughout purification, incorporation of 10-20% glycerol and maintenance of pH between 7.0-8.0 enhances protein stability. For functional studies, it's critical to maintain the protein in detergent micelles or reconstituted in phospholipid vesicles to preserve native conformation and activity .

How can researchers accurately measure the enzymatic activity of recombinant D. elephantipes NQO subunit 3?

Accurately measuring the enzymatic activity of recombinant D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3 requires careful experimental design. The following methodological approach is recommended:

  • Spectrophotometric assays:

    • Monitor NAD(P)H oxidation at 340 nm (ε = 6,220 M⁻¹cm⁻¹)

    • Reaction mixture: 50 mM phosphate buffer (pH 7.4), 0.2 mM NAD(P)H, varied concentrations of quinone substrates (10-100 μM)

    • Calculate initial rates from linear portions of absorbance vs. time plots

  • Oxygen consumption measurements:

    • Clark-type electrode to monitor oxygen consumption during quinone cycling

    • Reaction conditions: 25°C in air-saturated buffer, with enzyme concentration of 1-5 μg/ml

  • Artificial electron acceptors:

    • 2,6-dichloroindophenol (DCIP) and menadione as model substrates

    • DCIP reduction can be monitored at 600 nm (ε = 21,000 M⁻¹cm⁻¹)

  • Kinetic parameters determination:

    • Vary substrate concentrations to determine Km and kcat values

    • Use Lineweaver-Burk or Eadie-Hofstee plots for data analysis

    • Account for potential negative cooperativity observed in NQO enzymes

For intact complex activity measurement, reconstitution with other NDH subunits may be necessary, as individual subunits often show limited activity compared to the fully assembled complex .

What techniques are most effective for studying protein-protein interactions involving this enzyme?

Investigating protein-protein interactions of D. elephantipes NQO subunit 3 requires specialized techniques to account for its membrane protein nature. The following approaches have proven effective:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against subunit 3 or potential interacting partners

    • Gentle solubilization with digitonin (1%) preserves protein complexes

    • Western blotting to identify co-precipitated proteins

  • Cross-linking mass spectrometry (XL-MS):

    • Chemical cross-linkers like BS3 or DSS to capture transient interactions

    • MS/MS analysis to identify cross-linked peptides

    • Data processing with specialized software (e.g., xQuest, pLink)

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE):

    • Separation of intact protein complexes

    • Second-dimension SDS-PAGE to identify complex components

    • Particularly useful for studying integration into larger NDH complexes

  • Förster resonance energy transfer (FRET):

    • Fusion of fluorescent proteins to subunit 3 and potential partners

    • Live-cell imaging to detect interactions

    • Calculate FRET efficiency to quantify interaction strength

  • Isothermal titration calorimetry (ITC):

    • For purified components to determine binding thermodynamics

    • Requires stable, detergent-solubilized protein preparations

These methods can reveal interactions with other NDH complex components, regulatory proteins, and potential interacting partners involved in chloroplast redox sensing and regulation .

How does D. elephantipes NAD(P)H-quinone oxidoreductase contribute to cold stress acclimation?

D. elephantipes NAD(P)H-quinone oxidoreductase plays a crucial role in cold stress acclimation through multiple mechanisms. Studies on chloroplast gene expression during cold acclimation reveal:

  • Translational regulation: Cold stress triggers significant translational regulation of chloroplast-encoded NDH complex subunits, including subunit 3, with minimal changes at the transcript level. This suggests post-transcriptional control is a primary response mechanism .

  • Altered electron transport: The NDH complex modulates cyclic electron flow around photosystem I during cold stress, which helps:

    • Maintain redox balance in the chloroplast

    • Generate additional ATP without NADPH production

    • Protect photosynthetic apparatus from photoinhibition

  • ROS management: The enzyme contributes to reactive oxygen species (ROS) detoxification by:

    • Preventing one-electron reduction of quinones that would generate harmful semiquinones

    • Catalyzing obligatory two-electron reduction to form stable hydroquinones

    • Indirectly supporting antioxidant systems through NAD(P)H management

Research in tobacco has demonstrated that cold-triggered dynamics in chloroplast translation of NDH subunits are distinct from high-light-induced effects, suggesting a specialized role in temperature-specific acclimation .

What is the role of NAD(P)H-quinone oxidoreductase in regulating chloroplast redox homeostasis?

The chloroplastic NAD(P)H-quinone oxidoreductase subunit 3 plays a central role in maintaining redox homeostasis through several interconnected mechanisms:

  • NAD+/NADH ratio regulation: The enzyme influences the NAD+/NADH ratio in chloroplasts by catalyzing the oxidation of NADH, which has downstream effects on:

    • Activation of NAD+-dependent enzymes

    • Modulation of chloroplast sirtuin activity

    • Regulation of energy metabolism pathways

  • Quinone pool management: By reducing quinones to hydroquinones, the enzyme:

    • Prevents accumulation of reactive semiquinones

    • Maintains appropriate redox state of the plastoquinone pool

    • Influences electron transport chain efficiency

  • Interaction with antioxidant systems: The enzyme works in concert with other antioxidant systems by:

    • Complementing superoxide dismutase and catalase activities

    • Providing reduced equivalents for glutathione and ascorbate regeneration

    • Participating in stress-responsive signaling cascades

  • Photosynthetic regulation: During environmental stress conditions, NQO activity adjusts to:

    • Balance electron flow between photosystems

    • Prevent over-reduction of electron transport components

    • Protect against photooxidative damage

The enzyme's role in chloroplast redox homeostasis is particularly important during environmental stress conditions when electron transport chain components may become over-reduced, leading to ROS production and oxidative damage .

How does D. elephantipes NQO subunit 3 differ structurally from other plant species?

Comparative analysis of D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3 with homologs from other plant species reveals both conserved features and unique adaptations. Key structural differences include:

  • Transmembrane domain organization:

    • D. elephantipes shows distinct hydrophobicity patterns in transmembrane helices compared to other species

    • Analysis of sequences from Citrus sinensis, Saccharum officinarum, and Acorus americanus reveals species-specific variations in membrane-spanning regions

  • Substrate binding residues:

    • Variations in key amino acids within substrate binding pockets affect:

      • Substrate specificity

      • Binding affinity

      • Catalytic efficiency

  • Species-specific insertions/deletions:

    • D. elephantipes contains unique sequence elements not found in other plant species

    • These regions may confer specialized functions related to its adaptation to its natural environment

  • Evolutionary conservation analysis:

    • Highly conserved residues across species (shown in the table below)

    • Variable regions that may account for species-specific functions

RegionD. elephantipesCitrus sinensisSaccharum officinarumConservation level
N-terminalMFLLYKYD...MFLLYKYD...MFLLYK(F)D...High
TM helix 1IISSVIPIL...IISSVIPIA...VISSVIPIL...Moderate
Central loopLSSYESGIE...LSSYESGIE...LSSYESGVE...High
C-terminal...RKGALEWS...RKGALEWS...RKGSLEWSHigh

These structural differences likely reflect adaptations to D. elephantipes' unique ecological niche, which involves seasonal growth patterns and adaptation to arid environments with extreme temperature variations .

What functional differences have been observed between D. elephantipes NQO and homologs from model plant species?

Functional comparative analysis between D. elephantipes NAD(P)H-quinone oxidoreductase and homologs from model plant species reveals several important differences:

  • Catalytic efficiency:

    • D. elephantipes NQO exhibits distinct kinetic parameters compared to model species

    • Km values for NAD(P)H tend to be optimized for its specific metabolic requirements

    • Substrate preference shows adaptation to quinone species abundant in its native environment

  • Temperature response profiles:

    • D. elephantipes enzyme shows greater thermal stability, reflecting adaptation to its natural habitat

    • Maintains higher activity at elevated temperatures compared to temperate species homologs

    • Exhibits specialized cold response mechanisms, with translational regulation being particularly important

  • Regulatory mechanisms:

    • Species-specific post-translational modifications affect enzyme activity

    • Differential responses to redox status changes

    • Unique protein-protein interaction networks

  • Stress response patterns:

    • D. elephantipes NQO shows distinctive patterns of expression and activity modulation during:

      • Drought stress (reflecting adaptation to arid environments)

      • Temperature fluctuations (adaptation to seasonal changes)

      • Light intensity variations (coping with high irradiance in native habitat)

  • Integration with species-specific metabolic pathways:

    • Coordination with specialized secondary metabolite production pathways

    • Different roles in energy management during dormancy periods

These functional adaptations likely contribute to D. elephantipes' remarkable longevity (up to 70 years) and ability to survive extreme environmental conditions in its native South African habitat .

How can researchers design experiments to elucidate the role of specific amino acids in enzyme function?

Designing experiments to determine the functional significance of specific amino acids in D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3 requires a systematic approach:

  • Sequence-based target identification:

    • Perform multiple sequence alignment with homologs to identify conserved residues

    • Use protein structure prediction tools to identify functional domains

    • Focus on residues near FAD binding sites, NAD(P)H binding regions, and substrate interaction surfaces

  • Site-directed mutagenesis strategy:

    • Create point mutations using overlap extension PCR or commercial kits

    • Design mutations based on physicochemical properties:

      • Conservative substitutions (e.g., Asp→Glu) to test charge importance

      • Non-conservative changes (e.g., Tyr→Phe) to test hydroxyl group function

      • Alanine scanning for systematic functional analysis

  • Heterodimer approach for subunit function studies:

    • Generate wild-type/mutant heterodimers using polyhistidine tagging

    • Purify heterodimers via nickel-nitrilotriacetate chromatography

    • Compare properties with homodimeric wild-type and mutant enzymes

  • Kinetic characterization:

    • Determine Km and kcat values for both NAD(P)H and various quinone substrates

    • Test substrate specificities with two-electron acceptors (DCIP, menadione) and four-electron acceptors (methyl red)

    • Analyze data to distinguish between effects on binding versus catalysis

  • Structural verification:

    • Circular dichroism to confirm secondary structure integrity

    • Thermal stability assays to assess structural impact

    • Intrinsic fluorescence to monitor conformational changes

This approach has successfully revealed that subunits of NAD(P)H-quinone oxidoreductase function independently with two-electron acceptors but dependently with four-electron acceptors, providing insights into the complex mechanisms of these enzymes .

What approaches can be used to study the enzyme's role in chloroplast translational regulation during cold acclimation?

Investigating the role of D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3 in chloroplast translational regulation during cold acclimation requires integrative approaches spanning molecular biology, biochemistry, and systems biology:

  • Ribosome profiling of chloroplasts:

    • Isolate intact chloroplasts from control and cold-treated plants

    • Perform ribosome footprinting followed by next-generation sequencing

    • Analyze ribosome occupancy on ndhC mRNA to assess translational efficiency

    • Compare with transcriptomic data to identify translational regulation events

  • Polysome association analysis:

    • Fractionate chloroplast extracts on sucrose gradients

    • Quantify ndhC mRNA distribution across non-polysomal, monosomal, and polysomal fractions

    • Western blot analysis of fractions to correlate with protein synthesis

  • Reporter systems for translational regulation:

    • Construct chimeric genes with ndhC 5' UTR fused to reporter genes

    • Transform chloroplasts using biolistic methods

    • Monitor reporter expression during temperature shifts

  • RNA-protein interaction studies:

    • RNA electrophoretic mobility shift assays (EMSA) to detect RNA-binding proteins

    • RNA immunoprecipitation to identify proteins interacting with ndhC mRNA

    • Mass spectrometry to characterize the cold-responsive RNA-binding proteome

  • Inhibitor studies:

    • Use specific inhibitors of chloroplast translation (e.g., lincomycin)

    • Monitor effects on cold acclimation responses

    • Assess impact on photosynthetic efficiency and ROS production

  • In vitro translation systems:

    • Develop chloroplast-specific in vitro translation systems

    • Test effects of temperature, redox state, and regulatory factors

    • Quantify translation efficiency of ndhC mRNA under various conditions

These approaches can reveal how translational regulation of NQO contributes to plant chilling tolerance, which appears to be a crucial but previously underappreciated mechanism in plant cold acclimation .

How can D. elephantipes NAD(P)H-quinone oxidoreductase be utilized in studies of plant stress tolerance engineering?

D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3 offers significant potential for engineering enhanced stress tolerance in crop plants. Strategic research applications include:

  • Transgenic expression approaches:

    • Overexpression of D. elephantipes ndhC in crop species

    • Design of chimeric constructs combining D. elephantipes stress-responsive elements with crop ndhC coding sequences

    • CRISPR-mediated replacement of crop ndhC with D. elephantipes variant

  • Cold tolerance engineering:

    • Target translational regulation mechanisms identified in D. elephantipes

    • Incorporate regulatory elements that enhance NDH complex function during cold stress

    • Complement with additional cold-responsive factors for synergistic effects

  • Drought resistance applications:

    • Utilize D. elephantipes adaptations to water limitation

    • Engineer enhanced NDH complex activity during drought conditions

    • Focus on optimizing cyclic electron flow to maintain ATP production during stress

  • Oxidative stress protection strategies:

    • Leverage NQO's ability to prevent ROS formation

    • Engineer improved quinone reduction efficiency

    • Combine with other antioxidant systems for comprehensive protection

  • Predictive models for stress engineering:

    • Develop metabolic models incorporating D. elephantipes NQO function

    • Simulate effects of environmental stresses on electron transport

    • Identify optimal engineering targets based on model predictions

Given D. elephantipes' remarkable adaptations to extreme environments and its ability to survive for over 70 years, this species represents an excellent source of genetic material for improving stress tolerance in agricultural crops facing climate change challenges .

What are the most promising directions for future research on chloroplastic NAD(P)H-quinone oxidoreductases?

Future research on chloroplastic NAD(P)H-quinone oxidoreductases from D. elephantipes and related species should focus on several promising directions:

  • Structural biology advancements:

    • Cryo-EM structures of complete NDH complexes in different conformational states

    • Determination of high-resolution structures of individual subunits

    • Computational modeling of protein dynamics during catalysis

  • Synthetic biology applications:

    • Engineering minimal functional units for biotechnological applications

    • Design of hybrid enzymes with enhanced catalytic properties

    • Development of biosensors based on NQO redox sensitivity

  • Systems biology integration:

    • Multi-omics approaches to understand NQO roles in chloroplast metabolism

    • Network analysis of redox regulation pathways

    • Identification of regulatory hubs controlling NQO expression and activity

  • Translational regulation mechanisms:

    • Detailed characterization of cold-responsive translational machinery

    • Identification of RNA elements controlling ndhC translation

    • Development of tools to manipulate chloroplast translation efficiency

  • Evolutionary biology perspectives:

    • Comparative genomics across diverse plant lineages

    • Analysis of selection pressures on ndhC genes

    • Reconstruction of evolutionary history of NDH complex components

  • NAD+ metabolism connections:

    • Investigation of links between NQO activity and NAD+/NADH ratios

    • Studies of NQO roles in regulating sirtuins and other NAD+-dependent enzymes

    • Exploration of potential moonlighting functions beyond catalysis

These research directions will not only advance our fundamental understanding of chloroplast biology but also provide valuable tools for agricultural improvement and potentially novel therapeutic approaches based on NAD+ metabolism regulation .

What are the main challenges in expressing and purifying active recombinant D. elephantipes NQO subunit 3?

Researchers face several significant challenges when working with recombinant D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3, along with potential solutions:

  • Membrane protein expression issues:

    • Challenge: Poor expression levels and inclusion body formation

    • Solutions:

      • Use specialized E. coli strains (C41/C43) designed for membrane protein expression

      • Express as fusion with solubility-enhancing tags (MBP, SUMO)

      • Optimize growth conditions (lower temperature, reduced inducer concentration)

      • Consider cell-free expression systems for difficult constructs

  • Cofactor incorporation:

    • Challenge: Ensuring proper FAD incorporation during expression

    • Solutions:

      • Supplement growth media with riboflavin (FAD precursor)

      • Co-express flavin biosynthetic enzymes

      • Develop reconstitution protocols for apo-enzyme forms

      • Monitor FAD content spectrophotometrically during purification

  • Protein stability issues:

    • Challenge: Rapid degradation and loss of activity during purification

    • Solutions:

      • Include protease inhibitors throughout purification

      • Maintain low temperature (4°C) during all steps

      • Add stabilizing agents (glycerol 10-20%, reducing agents)

      • Test multiple detergents for optimal stability

  • Heterodimer formation challenges:

    • Challenge: Ensuring proper assembly of protein complexes

    • Solutions:

      • Use tagged/untagged co-expression strategies

      • Develop stepwise elution protocols from affinity columns

      • Validate heterodimer composition by SDS-PAGE and immunoblotting

      • Confirm by native PAGE analysis

  • Activity assessment difficulties:

    • Challenge: Low activity of isolated subunit versus complete complex

    • Solutions:

      • Develop sensitive assays using optimal substrates

      • Consider reconstitution with other complex components

      • Use artificial electron acceptors for initial characterization

      • Account for pH dependence of activity in assay design

Addressing these challenges requires an integrated approach combining molecular biology techniques, careful biochemical characterization, and appropriate activity assays tailored to the specific properties of the enzyme .

How can researchers overcome the challenges of studying protein-protein interactions in membrane-bound chloroplast proteins?

Studying protein-protein interactions of membrane-bound chloroplast proteins like D. elephantipes NAD(P)H-quinone oxidoreductase subunit 3 presents unique challenges requiring specialized techniques and approaches:

  • Membrane environment preservation:

    • Challenge: Maintaining native interactions during solubilization

    • Solutions:

      • Use mild detergents (digitonin, amphipols, nanodiscs)

      • Implement membrane mimetic systems (liposomes, bicelles)

      • Apply gentle solubilization protocols with optimized detergent:protein ratios

      • Consider on-membrane crosslinking prior to solubilization

  • Transient interaction detection:

    • Challenge: Capturing short-lived protein-protein interactions

    • Solutions:

      • Implement in vivo crosslinking with membrane-permeable agents

      • Use proximity labeling approaches (BioID, APEX)

      • Apply split-reporter systems adapted for chloroplast use

      • Develop time-resolved interaction detection methods

  • Complex assembly monitoring:

    • Challenge: Tracking NDH complex assembly pathways

    • Solutions:

      • Pulse-chase experiments with chloroplast-specific translation systems

      • Staged isolation of assembly intermediates using tagged components

      • Time-resolved proteomics during complex assembly

      • Single-molecule tracking in isolated chloroplasts

  • Conformational dynamics assessment:

    • Challenge: Understanding how protein mobility affects function

    • Solutions:

      • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

      • Site-directed spin labeling combined with EPR spectroscopy

      • Single-molecule FRET to detect conformational changes

      • NMR studies on selectively labeled proteins

  • Validation in native environments:

    • Challenge: Confirming interactions occur in vivo

    • Solutions:

      • Develop chloroplast-specific protein complementation assays

      • Implement FRET/FLIM imaging in intact chloroplasts

      • Use genetic approaches (suppressor screens, synthetic lethality)

      • Apply cryo-electron tomography to visualize complexes in situ

These approaches can help overcome the inherent difficulties in studying membrane protein interactions while providing valuable insights into the assembly, regulation, and function of the NDH complex in chloroplasts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.