Recombinant Dioscorea elephantipes NAD (P)H-quinone oxidoreductase subunit 4L, chloroplastic

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplasts

This subunit participates in the chloroplast NDH complex, which operates in two primary pathways:

  • Cyclic Electron Flow (CEF): Recirculates electrons to enhance ATP synthesis under stress .

  • Chlororespiration: Maintains redox balance by oxidizing NADPH and reducing plastoquinone .

Mechanistically, it shuttles electrons from NAD(P)H to plastoquinone via FMN and iron-sulfur clusters, coupling redox reactions to proton translocation . This activity is critical for mitigating oxidative damage during high-light stress .

Research Applications

This recombinant protein is widely utilized in:

ApplicationPurpose
Enzyme KineticsStudying plastoquinone reduction rates and inhibitor interactions .
Photosynthesis ResearchProbing NDH's role in stress adaptation and photoprotection .
Antibody ProductionGenerating specific antibodies for chloroplast protein localization .
Structural BiologyServing as a template for homology modeling of plant NDH complexes .

Challenges and Future Directions

  • Stability Issues: The protein requires strict storage at -80°C to prevent aggregation .

  • Species-Specific Variations: Functional disparities between Dioscorea and model plants (e.g., Arabidopsis) necessitate cautious extrapolation .

  • Therapeutic Potential: While human NQO1 homologs are cancer targets , plant NDH applications remain focused on agricultural biotechnology .

Ongoing research aims to resolve its 3D structure and engineer thermostable variants for industrial applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
ndhE; NAD(PH-quinone oxidoreductase subunit 4L, chloroplastic; NAD(PH dehydrogenase subunit 4L; NADH-plastoquinone oxidoreductase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
ndhE
Target Protein Sequence
MMFEHVLVLSVYLFSIGIYGLITSRNMVRALMCLDLILNSVNMNLVTFSDLFDSRQLKGD IFSIFVIAVAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN
Uniprot No.

Target Background

Function
NDH facilitates electron transfer from NAD(P)H:plastoquinone, through FMN and iron-sulfur (Fe-S) centers, to quinones in the photosynthetic chain and potentially in a chloroplast respiratory chain. In this species, the immediate electron acceptor for the enzyme is thought to be plastoquinone. It couples the redox reaction with proton translocation, thus conserving the redox energy in a proton gradient.
Protein Families
Complex I subunit 4L family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is NAD(P)H-quinone oxidoreductase and what role does it play in Dioscorea elephantipes?

NAD(P)H-quinone oxidoreductase is a crucial enzyme complex located in the chloroplast of Dioscorea elephantipes. It plays an essential role in electron transport during photosynthesis, catalyzing the reduction of plastoquinone from NAD(P)H. In D. elephantipes, this protein is particularly important for the plant's adaptation to its native arid environment in southern Africa, where it grows on rocks and stony slopes at elevations between 150 and 1,200 meters above sea level . The chloroplastic nature of this protein indicates its involvement in energy production processes specific to this xerophytic species, contributing to its remarkable survival capabilities in harsh conditions.

How does the chloroplast genome of Dioscorea elephantipes differ from other Dioscorea species?

The chloroplast genome of Dioscorea elephantipes has been completely sequenced and displays distinctive features compared to other Dioscorea species. Comparative analysis of nine Dioscorea chloroplast genomes revealed structural differentiations that provide insights into evolutionary relationships within the genus . The D. elephantipes chloroplast genome (GenBank accession: EF380353.1) serves as a reference for comparative studies and can be aligned with other species using tools like MAFFT v7 to identify variations . Through sliding window analysis with DnaSP software, researchers have identified nucleotide diversity patterns that differentiate D. elephantipes from related species, with particular attention to gene order rearrangements and IR (Inverted Repeat) expansions or contractions .

What expression systems are typically used for producing recombinant D. elephantipes NAD(P)H-quinone oxidoreductase?

The recombinant protein is typically expressed in E. coli expression systems, as indicated by commercial preparations . For research applications, the choice of expression system depends on specific experimental requirements. While E. coli is commonly used for its efficiency and cost-effectiveness, alternative expression systems include wheat germ extract (similar to that used for human NADPH oxidase 4 ), which may offer advantages for maintaining proper folding of plant proteins. When designing expression vectors, researchers should consider codon optimization for the host organism and the addition of appropriate purification tags that minimize interference with protein function.

What are the optimal conditions for maintaining enzyme activity during purification of D. elephantipes NAD(P)H-quinone oxidoreductase?

For optimal enzyme activity preservation during purification, researchers should consider:

  • Temperature control: Maintain temperatures between 0-4°C throughout the purification process

  • Buffer composition: Use buffers containing:

    • 50 mM Tris-HCl (pH 7.5)

    • 150 mM NaCl

    • 10% glycerol as a stabilizing agent

    • 1 mM DTT to maintain reduced states of cysteine residues

  • Protease inhibitor cocktail: Include to prevent degradation

  • Gentle elution conditions: When using affinity chromatography

Activity assays should be performed immediately after purification steps to monitor enzyme integrity, as the NAD(P)H-dependent quinone reduction activity can diminish rapidly. For long-term storage, flash freezing in liquid nitrogen with cryoprotectants has shown better activity preservation than conventional freezing methods.

How can researchers effectively measure the enzymatic activity of recombinant D. elephantipes NAD(P)H-quinone oxidoreductase?

The enzymatic activity of recombinant D. elephantipes NAD(P)H-quinone oxidoreductase can be measured through:

  • Spectrophotometric assays:

    • Monitor the oxidation of NAD(P)H at 340 nm

    • Measure quinone reduction at appropriate wavelengths

  • Oxygen consumption assays:

    • Using Clark-type electrodes to detect oxygen reduction byproducts

  • H₂O₂ production measurement:

    • Similar to NADPH oxidase 4, which predominantly produces H₂O₂ rather than superoxide

A typical reaction mixture contains:

ComponentConcentration
Purified enzyme5-20 μg/mL
NAD(P)H100-200 μM
Quinone substrate50-100 μM
Buffer (Tris-HCl pH 7.5)50 mM
NaCl100 mM
Temperature25-30°C

Activity should be expressed as μmol of NAD(P)H oxidized or quinone reduced per minute per mg of enzyme.

What strategies can be employed to improve solubility and yield of recombinant D. elephantipes NAD(P)H-quinone oxidoreductase?

To improve solubility and yield of the recombinant protein, researchers should consider:

  • Expression conditions optimization:

    • Induction at lower temperatures (16-20°C)

    • Reduced IPTG concentrations (0.1-0.5 mM)

    • Extended expression time (overnight)

  • Co-expression with molecular chaperones:

    • GroEL/GroES system

    • DnaK, DnaJ, and GrpE

  • Fusion tags selection:

    • MBP (Maltose Binding Protein) tag often improves solubility

    • SUMO tag with subsequent removal via SUMO protease

  • Buffer additives during purification:

    • Non-ionic detergents (0.1% Triton X-100)

    • Osmolytes like glycine or arginine (50-100 mM)

  • Cell lysis optimization:

    • Gentler lysis methods using enzymatic approaches rather than sonication

    • Inclusion of DNase to reduce viscosity

These strategies have been adapted from successful approaches with similar chloroplastic proteins and can significantly increase functional protein yield.

How does the structure of D. elephantipes NAD(P)H-quinone oxidoreductase relate to its function in the chloroplast electron transport chain?

The structure-function relationship of D. elephantipes NAD(P)H-quinone oxidoreductase reveals adaptations specific to the chloroplast environment. The protein contains multiple transmembrane domains that anchor it within the thylakoid membrane, positioning the catalytic domains optimally for electron transfer. Key structural features include:

  • NAD(P)H binding domain: Contains a conserved Rossmann fold

  • Quinone binding pocket: Shaped to accommodate plastoquinone specifically

  • Fe-S clusters: Positioned to facilitate sequential electron transfer

  • Membrane-spanning regions: Typically comprising 4-6 transmembrane helices

These structural elements enable efficient electron transfer from stromal NAD(P)H to membrane-bound plastoquinone, supporting photosynthetic processes that are critical for D. elephantipes survival in its unique habitat where it grows "on rocks exposed to all weathers, on stony and arid slopes" .

What approaches can be used to study the interaction between D. elephantipes NAD(P)H-quinone oxidoreductase and other components of the photosynthetic machinery?

Several methodological approaches can elucidate these interactions:

  • Co-immunoprecipitation studies:

    • Using antibodies against the recombinant protein to pull down interacting partners

    • Mass spectrometry identification of co-precipitated proteins

  • Blue native polyacrylamide gel electrophoresis (BN-PAGE):

    • To isolate intact protein complexes from chloroplast membranes

    • Followed by second-dimension SDS-PAGE to identify complex components

  • Surface plasmon resonance (SPR):

    • For quantitative binding kinetics with purified interaction partners

    • Enables determination of kon and koff rates

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • To map protein-protein interaction surfaces

    • Identifies regions protected from exchange during complex formation

  • Cryogenic electron microscopy:

    • For structural visualization of the entire complex

    • Particularly useful for membrane-embedded complexes

These complementary approaches provide a comprehensive understanding of how the oxidoreductase integrates into the larger photosynthetic apparatus.

How is the gene encoding NAD(P)H-quinone oxidoreductase organized in the D. elephantipes chloroplast genome?

The gene encoding NAD(P)H-quinone oxidoreductase in D. elephantipes is organized within the chloroplast genome in a manner that reflects both conservation and species-specific adaptations. Based on chloroplast genome analysis:

  • Gene location: The gene is typically located in the large single-copy (LSC) region of the chloroplast genome

  • Gene structure: Contains conserved exons and introns with specific splicing requirements

  • Regulatory elements: Includes promoter regions adapted to chloroplast transcription machinery

  • Context: Often found in operons or gene clusters with other components of the photosynthetic apparatus

Comparison of nine Dioscorea chloroplast genomes shows that while the gene sequence is largely conserved, there are species-specific variations that can be identified through sliding window analysis and nucleotide diversity examination . These variations may correlate with adaptations to different ecological niches, such as the arid habitat of D. elephantipes.

What techniques are most effective for analyzing expression patterns of the D. elephantipes NAD(P)H-quinone oxidoreductase gene in different tissues and developmental stages?

For comprehensive expression analysis, researchers should employ multiple complementary techniques:

  • RNA-Seq analysis:

    • Provides quantitative transcriptome-wide expression data

    • Allows for identification of alternative splicing variants

    • Enables co-expression network analysis

  • Quantitative RT-PCR:

    • For targeted validation of expression levels

    • Higher sensitivity for low-abundance transcripts

    • Recommended primer design spanning exon junctions

  • In situ hybridization:

    • Visualizes spatial expression patterns within tissues

    • Particularly valuable for understanding developmental regulation

  • Proteomics approaches:

    • Western blotting with specific antibodies

    • Targeted proteomics using selected reaction monitoring (SRM)

For D. elephantipes specifically, tissue sampling should include:

  • Developing vs. mature caudex tissue

  • Aerial stems at different developmental stages

  • Male and female flowers (as it is a dioecious plant )

  • Root tissues

Each tissue type requires specific extraction protocols to account for the distinctive biochemical properties of this succulent plant with its woody, cork-like exterior and succulent interior .

How has the D. elephantipes NAD(P)H-quinone oxidoreductase evolved compared to homologs in other plant species?

Evolutionary analysis of D. elephantipes NAD(P)H-quinone oxidoreductase reveals interesting patterns of conservation and adaptation. Phylogenetic studies based on chloroplast genome sequences indicate:

  • Core catalytic domains: Highly conserved across plant lineages, reflecting functional constraints

  • Regulatory regions: More variable, suggesting adaptation to specific photosynthetic requirements

  • Codon usage: Shows optimization patterns specific to D. elephantipes

  • Selection pressure: Evidence of positive selection in specific protein regions that may relate to arid environment adaptation

The construction of phylogenetic trees using complete chloroplast genome sequences provides higher resolution compared to using limited molecular markers like rbcL, matK, trnH-psbA, or trnL-F . This approach has enhanced our understanding of how this protein has evolved alongside the adaptation of D. elephantipes to its challenging habitat in the arid karroid regions of southern Africa, where it grows "on rocks exposed to all weathers" .

What insights can comparative chloroplast genomics provide about the evolution of NAD(P)H-quinone oxidoreductase in Dioscorea species?

Comparative chloroplast genomics offers valuable insights into the evolution of this enzyme across Dioscorea species:

  • Sequence divergence patterns:

    • Analysis of nine complete Dioscorea chloroplast genomes reveals variation hotspots

    • The mVISTA program using Shuffle-LAGAN mode with D. elephantipes as reference allows identification of conserved and variable regions

  • Structural variation:

    • Gene order rearrangements and IR expansions/contractions provide evolutionary markers

    • Small inversions detected through manual adjustment after MAFFT alignment

  • Selection pressure analysis:

    • Calculation of Ka/Ks ratios reveals regions under positive or purifying selection

    • Correlation with functional domains suggests adaptive significance

  • Divergence dating:

    • Molecular clock analyses using chloroplast sequences help establish the timeline of Dioscorea diversification

    • Relates to geological events that may have influenced speciation

These approaches have helped establish relationships between D. elephantipes and related species (D. rotundata, D. villosa, D. zingiberensis) , providing context for understanding the functional evolution of NAD(P)H-quinone oxidoreductase in response to different ecological pressures.

What are common challenges in expression and purification of recombinant D. elephantipes NAD(P)H-quinone oxidoreductase and how can they be addressed?

Researchers frequently encounter several challenges when working with this protein:

  • Inclusion body formation:

    • Challenge: Protein aggregation during expression

    • Solution: Lower expression temperature (16°C), co-expression with chaperones, fusion with solubility-enhancing tags

  • Low activity after purification:

    • Challenge: Loss of cofactors or improper folding

    • Solution: Include cofactors in purification buffers, gentle purification methods, verify integrity by spectroscopic methods

  • Oxidative damage:

    • Challenge: Oxidation of critical cysteine residues

    • Solution: Include reducing agents (DTT, β-mercaptoethanol) in all buffers, work under nitrogen atmosphere when possible

  • Membrane association difficulties:

    • Challenge: Poor solubilization of the membrane-associated domains

    • Solution: Optimize detergent type and concentration, consider amphipols for maintaining native conformation

  • Heterogeneity in preparations:

    • Challenge: Multiple conformational states complicating analysis

    • Solution: Size exclusion chromatography as final purification step, analytical ultracentrifugation to verify homogeneity

These solutions are derived from approaches that have proven successful with related chloroplastic proteins and can significantly improve experimental outcomes.

What controls and validation steps should be included in functional studies of recombinant D. elephantipes NAD(P)H-quinone oxidoreductase?

Robust experimental design requires appropriate controls and validation:

  • Activity controls:

    • Positive control: Known functional homolog from a well-characterized species

    • Negative control: Heat-inactivated enzyme preparation

    • Background control: Reaction mixture without enzyme

  • Specificity validation:

    • Substrate panel testing with various quinones and electron donors

    • Inhibitor profiling using known inhibitors of similar enzymes

    • Competition assays with structural analogs

  • Structural integrity confirmation:

    • Circular dichroism to verify secondary structure content

    • Thermal shift assays to assess stability

    • Limited proteolysis to evaluate folding quality

  • Expression validation:

    • Western blotting with antibodies against the protein or tag

    • Mass spectrometry verification of protein identity

    • N-terminal sequencing to confirm correct processing

  • Functional correlation:

    • Complementation studies in model systems

    • Activity correlation with physiological parameters in reconstituted systems

These validation steps ensure that experimental results accurately reflect the properties of the native protein and are not artifacts of the recombinant expression system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.