Recombinant Dioscorea elephantipes Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us; we will prioritize its inclusion in the production process.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
ycf4
Target Protein Sequence
MNWRSEHIWIELITGSRKTSNFCWACILFLGSLGFLVVGTSSYLGRNLISVFPSQQIIFF PQGIVMSFYGIAGLFISSYLWCTISWNVGSGYDRFDRKEGIVCIFRWGFPGINRRIFLRF LMRDIQSIRMQVKEGLYPRRVLYMEIRGQGAIPLTRTDENFTPREIEQKAAELAYFLRVP IEGKRN
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Ycf4 in photosystem I assembly?

Ycf4 functions as a critical auxiliary factor in the assembly of the photosystem I (PSI) complex, which is essential for light-dependent reactions in photosynthesis. Research has demonstrated that Ycf4 forms modules that mediate PSI assembly by facilitating the integration of peripheral PSI subunits and light-harvesting complex I (LHCI) proteins into the PSI reaction center subcomplex . Without Ycf4, photosynthesis would be inefficient, significantly affecting plant growth .

The protein's designation as "Ycf" (hypothetical chloroplast open reading frame) reflects its initial identification before its function was fully characterized. Biochemical studies have shown that Ycf4 co-fractionates with a protein complex larger than PSI during sucrose density gradient centrifugation of solubilized thylakoids, suggesting its involvement in the formation of assembly intermediates .

Where is the ycf4 gene located in the Dioscorea elephantipes chloroplast genome?

The ycf4 gene is located in the chloroplast genome of Dioscorea elephantipes, which has been completely sequenced and is available in GenBank (accession: EF380353.1) . The D. elephantipes chloroplast genome is 152,609 bp in size, consisting of a large single copy (LSC) region (82,777–85,600 bp), a small single copy (SSC) region (18,806–19,038 bp), and a pair of inverted repeat (IR) regions (25,464–25,576 bp) .

While the search results don't explicitly specify the exact location of ycf4 within the D. elephantipes chloroplast genome, in most plant species, ycf4 is typically located in the LSC region. Complete analysis of the D. elephantipes chloroplast genome sequence would reveal the precise location and genomic context of the ycf4 gene.

How conserved is the Ycf4 protein sequence across Dioscorea species?

Comparative genomic analyses of chloroplast genomes across Dioscorea species have been conducted using multiple alignment tools such as MAFFT v7 and DnaSP software . These studies enable the assessment of sequence conservation patterns among different species, including D. elephantipes, D. villosa, D. zingiberensis, D. rotundata, D. aspersa, D. alata, and D. bulbifera .

While specific conservation data for ycf4 isn't explicitly provided in the available research, the essential nature of Ycf4 in photosynthesis suggests that functionally important domains would be highly conserved across Dioscorea species. Conservation analysis is typically performed through sliding window analysis, which can identify regions of high conservation that likely represent functional domains critical for protein-protein interactions and PSI assembly functions.

What expression systems are optimal for producing functional recombinant D. elephantipes Ycf4?

The production of functional recombinant D. elephantipes Ycf4 presents challenges due to its membrane protein nature. Based on general principles for recombinant membrane protein expression, several systems can be considered:

Expression SystemAdvantagesDisadvantagesBest For
E. coli (C41/C43)High yield, easy manipulationMay lack proper folding machineryInitial screens, structural studies
Yeast (P. pastoris)Eukaryotic processing, good for membrane proteinsLonger process, lower yieldsFunctional studies
Insect cellsPost-translational modificationsExpensive, complexNative-like protein production
Plant-based systemsNative environmentLow yieldFunctional validation
Cell-free with lipidsAvoids toxicity, direct membrane integrationExpensive, technically challengingDifficult-to-express proteins

For initial characterization, E. coli strains specifically designed for membrane protein expression (like C41/C43) combined with solubility-enhancing fusion partners (MBP, SUMO) provide a practical starting point. For functional studies, plant-based expression systems may better preserve authentic Ycf4 activity despite lower yields.

The gene sequence should be codon-optimized for the chosen expression host, and the construct should include appropriate fusion tags to facilitate purification while maintaining protein function.

How can researchers verify the functionality of recombinant Ycf4 in vitro?

Verifying the functionality of recombinant D. elephantipes Ycf4 requires assays that assess its ability to facilitate PSI assembly. A comprehensive approach includes:

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to verify proper folding compared to native Ycf4

    • Membrane integration analysis using fluorescence or ultracentrifugation methods

  • Binding and interaction assays:

    • Co-immunoprecipitation with PSI subunits

    • Surface plasmon resonance to measure binding kinetics with PSI components

    • Crosslinking studies followed by mass spectrometry to identify interaction sites

  • Functional reconstitution assays:

    • In vitro PSI assembly using recombinant Ycf4 and PSI components

    • Blue native PAGE or sucrose gradient ultracentrifugation to visualize complex formation

    • Complementation assays in ycf4-deficient systems

A robust experimental workflow would progress from biophysical characterization of the purified protein to increasingly complex functional assays, culminating in demonstration of PSI assembly facilitation.

What methods are most effective for analyzing protein-protein interactions involving Ycf4?

Analyzing protein-protein interactions involving Ycf4 requires techniques suitable for membrane proteins. The following approaches are particularly effective:

  • In vitro interaction methods:

    • Chemical crosslinking coupled with mass spectrometry (XL-MS): Identifies specific residues involved in interactions between Ycf4 and PSI components

    • Co-purification assays: Using tagged Ycf4 to capture interacting proteins

    • Microscale thermophoresis: Measures binding affinities in solution with minimal protein consumption

  • Structural approaches:

    • Cryo-electron microscopy: Visualizes Ycf4-PSI complexes at high resolution

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps interaction surfaces through solvent accessibility changes

  • Comparative data analysis:

TechniqueResolutionSample RequirementsInformation ObtainedLimitations
XL-MSAmino acid~100 μg proteinSpecific contact pointsLimited by crosslinker chemistry
Co-IPProtein levelNative or recombinantComplex compositionDetects indirect interactions
Cryo-EM3-4 ÅHighly purified complexesFull 3D structureRequires stable complexes
HDX-MSPeptide level~50 μg proteinBinding interfaces, dynamicsModerate resolution
SPRN/AImmobilized proteinBinding kinetics, affinitySurface artifacts possible

An integrated approach using multiple complementary techniques provides the most comprehensive understanding of Ycf4's interaction network during PSI assembly.

How does the structure of Ycf4 relate to its function in PSI assembly?

Ycf4 is firmly associated with the thylakoid membrane, presumably through transmembrane domains . While high-resolution structural data specifically for D. elephantipes Ycf4 is not readily available, functional analyses suggest the following structural features are critical for its assembly function:

  • Membrane integration elements: Transmembrane helices anchor Ycf4 to the thylakoid membrane, positioning it correctly for PSI assembly .

  • Protein-protein interaction domains: Specific regions mediate interactions with PSI subunits and other assembly factors. These interaction domains enable Ycf4 to function as part of an assembly apparatus along with other factors like Ycf3 .

  • Oligomerization interfaces: Research indicates that Ycf4 forms oligomeric structures that create a platform for the integration of peripheral PSI subunits and LHCIs . These oligomerization domains are essential for its assembly function.

The Ycf4 protein forms part of a larger assembly apparatus that includes the Ycf3-Y3IP1 module, which primarily facilitates reaction center subunit assembly . Together, these modules coordinate the stepwise assembly of the complete PSI-LHCI complex.

What molecular mechanisms enable Ycf4 to facilitate PSI complex assembly?

Ycf4 facilitates PSI assembly through several molecular mechanisms:

  • Scaffold formation: Ycf4 appears to form oligomeric structures that serve as platforms for the ordered assembly of PSI components .

  • Subunit integration: Research demonstrates that Ycf4 specifically facilitates the integration of peripheral PSI subunits and light-harvesting complex I (LHCI) proteins into the PSI reaction center subcomplex .

  • Coordinated assembly with other factors: Ycf4 works in concert with the Ycf3-Y3IP1 module in a coordinated manner, with Ycf3-Y3IP1 facilitating reaction center assembly and Ycf4 mediating peripheral subunit integration .

  • Membrane organization: Ycf4's thylakoid membrane association positions it ideally to organize the membrane-associated assembly process, potentially creating localized environments favorable for PSI complex formation .

Biochemical evidence suggests that Ycf4 co-fractionates with protein complexes larger than PSI during sucrose density gradient centrifugation, indicating its involvement in assembly intermediate formation rather than being a structural component of the final PSI complex .

How might site-directed mutagenesis of conserved Ycf4 domains inform our understanding of its function?

Site-directed mutagenesis of conserved Ycf4 domains provides a powerful approach to dissect structure-function relationships. A systematic mutagenesis strategy should target:

  • Predicted transmembrane regions: Mutations in these domains would reveal their importance for membrane integration and correct protein orientation.

  • Conserved motifs: Highly conserved amino acid sequences likely represent functionally critical regions involved in specific interactions or activities.

  • Predicted protein-protein interaction sites: Mutations at these sites could disrupt specific interactions with PSI components.

A comprehensive mutagenesis study might generate results similar to this hypothetical data table:

MutationDomainPSI Assembly (%)Photosynthetic Activity (%)Interaction with PSI Components
Wild-type-100100Normal
K45ATM19095Slightly reduced
R67ALoop17580Moderately reduced
D103ATM24045Severely impaired
W120ALoop22025Nearly abolished
Y142ATM31510Abolished

Such data would reveal which regions are essential for function versus those that play supportive roles, informing more targeted investigations of specific mechanistic aspects of Ycf4 function.

How should researchers analyze and interpret Ycf4 sequence conservation across photosynthetic lineages?

Analyzing Ycf4 sequence conservation requires a systematic approach to distinguish functionally important regions from less constrained areas:

  • Multiple sequence alignment: Use tools like MAFFT to align Ycf4 sequences from diverse photosynthetic organisms, including multiple Dioscorea species .

  • Conservation scoring: Apply quantitative measures of conservation at each position using programs like ConSurf or DnaSP .

  • Sliding window analysis: Implement a sliding window approach (e.g., 800 bp window with 200 bp step size) to identify regions of high and low nucleotide diversity, as demonstrated in chloroplast genome analyses .

  • Domain correlation: Map conservation patterns to predicted functional domains and protein structures.

  • Interpretation framework:

Conservation PatternPotential InterpretationResearch Implication
Universally conserved residuesCritical for core functionPrimary targets for functional studies
Lineage-specific conservationAdaptation to specific photosynthetic requirementsInvestigate specialized functions
Variable regionsStructural flexibility or non-essential regionsLess critical for function
Co-evolving residuesMaintain physical interactionsGuide interaction studies

When analyzing D. elephantipes Ycf4 specifically, researchers should compare it with other Dioscorea species as well as more distant relatives to identify both genus-specific features and universally conserved elements.

What statistical approaches should be used to evaluate Ycf4 co-purification experiments?

Co-purification experiments with Ycf4 require robust statistical analysis to distinguish genuine interaction partners from background contaminants. Recommended statistical approaches include:

  • Fold enrichment analysis:

    • Calculate the ratio of protein abundance in Ycf4 pull-down versus control samples

    • Apply log transformation to normalize distributions

    • Set threshold values (typically >2-fold enrichment) for significance

  • Significance testing:

    • Implement t-tests or ANOVA to assess statistical significance across replicates

    • Apply Benjamini-Hochberg correction for multiple hypothesis testing

    • Use SAINT (Significance Analysis of INTeractome) for probabilistic scoring

  • Visualization and interpretation:

    • Generate volcano plots (log₂ fold change vs. -log₁₀ p-value)

    • Create interaction networks with edge weights based on statistical confidence

  • Confidence classification system:

Confidence LevelFold EnrichmentAdjusted p-valueReproducibility
High confidence>4-fold<0.01All replicates
Medium confidence2-4-fold<0.05≥75% of replicates
Low confidence1.5-2-fold<0.1≥50% of replicates

When analyzing D. elephantipes Ycf4 specifically, researchers should incorporate knowledge about expected PSI assembly factors as positive controls and use appropriate negative controls like non-specific antibody pull-downs or unrelated chloroplast proteins.

How can comparative genomics of Ycf4 across Dioscorea species inform evolutionary adaptations in photosynthesis?

Comparative genomic analysis of Ycf4 across Dioscorea species provides insights into photosynthetic adaptation and evolution. Methodological approaches include:

  • Complete chloroplast genome sequencing: The chloroplast genomes of multiple Dioscorea species have been sequenced, including D. elephantipes (152,609 bp), D. rotundata (155,418 bp), and others .

  • Comparative sequence analysis: Use tools like mVISTA with Shuffle-LAGAN mode to compare Dioscorea chloroplast genomes, with D. elephantipes as a reference .

  • Nucleotide diversity assessment: Apply sliding window analysis using software like DnaSP v5.10 to identify conserved and variable regions .

  • Phylogenetic reconstruction: Build phylogenetic trees using maximum likelihood and Bayesian inference methods to understand evolutionary relationships .

Research questions that could be addressed include:

  • Have specific domains of Ycf4 undergone adaptive evolution in Dioscorea lineages adapted to different light environments?

  • Does Ycf4 show co-evolutionary patterns with other PSI components across Dioscorea species?

  • Are there correlation between Ycf4 sequence features and photosynthetic efficiency in different Dioscorea species?

Such comparative analyses would connect molecular evolution to functional adaptations in photosynthesis.

What approaches can be used to study the interaction between Ycf4 and other PSI assembly factors?

Investigating interactions between Ycf4 and other PSI assembly factors requires integrating multiple experimental approaches:

  • In vivo interaction studies:

    • Bimolecular Fluorescence Complementation (BiFC): Visualize interactions in intact chloroplasts

    • Co-immunoprecipitation with native antibodies: Pull down native complexes from thylakoid membranes

    • In vivo crosslinking: Capture transient interactions during assembly

  • Structural biology approaches:

    • Cryo-electron microscopy: Visualize assembly intermediates containing Ycf4 and other factors

    • Integrative structural modeling: Combine low-resolution EM data with crosslinking and computational modeling

  • Functional interplay analysis:

    • Genetic epistasis testing: Create single and double mutants of Ycf4 and other assembly factors

    • Conditional expression systems: Control the timing and levels of different assembly factors

Of particular interest is the interaction between Ycf4 and the Ycf3-Y3IP1 module, as research indicates these form distinct modules that cooperate in PSI assembly . The Ycf3-Y3IP1 module mainly facilitates reaction center subunit assembly, while the Ycf4 module facilitates peripheral subunit integration .

Researchers should design experiments that can distinguish between assembly factors that function in the same pathway versus those that operate in parallel pathways, using quantitative measures of PSI assembly efficiency as readouts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.