Recombinant Dioscorea elephantipes Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Dioscorea elephantipes Photosystem II CP47 Chlorophyll Apoprotein (psbB)

The Recombinant Dioscorea elephantipes Photosystem II CP47 Chlorophyll Apoprotein (psbB) is a full-length, His-tagged protein expressed in E. coli for research applications. It corresponds to the UniProt entry A6MMN3 (1–508 amino acids) and is critical for photosynthesis as a core component of Photosystem II (PSII), where it stabilizes chlorophyll molecules and facilitates light absorption . This recombinant protein is produced to study PSII assembly, chlorophyll-protein interactions, and photosynthetic mechanisms in plants .

Protein Structure

  • Length: 508 amino acids .

  • Molecular Weight: ~56 kDa (theoretical) .

  • Domains: Contains six transmembrane helices with large extrinsic loops that bind chlorophyll a and β-carotene .

Functional Role in Photosynthesis

  • CP47 (psbB gene product) acts as an inner antenna in PSII, transferring energy from light-harvesting complexes to the PSII reaction center .

  • Stabilizes chlorophyll a and facilitates the assembly of the oxygen-evolving complex (OEC) .

  • Requires chlorophyll binding for structural stability; degradation occurs in chlorophyll-deficient environments .

Key Properties

PropertyDetail
SourceE. coli-expressed, full-length D. elephantipes psbB .
Purity>90% (SDS-PAGE) .
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0) .
Reconstitution0.1–1.0 mg/mL in sterile water; glycerol (5–50%) recommended .

Amino Acid Sequence

The N-terminal His-tagged sequence begins with:
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM... .

Chlorophyll Dependency

  • CP47 stability is directly linked to chlorophyll a or Zn-pheophytin a binding. Zn-pheophytin a stabilizes CP47 more efficiently than chlorophyll a at lower concentrations .

  • In vitro studies show that chlorophyll binding reduces proteolytic degradation of CP47 by up to 90% .

Regulatory Factors

  • The RNA-binding protein HCF107 stabilizes psbB mRNA and promotes CP47 synthesis in Arabidopsis. Mutants lacking HCF107 show reduced CP47 accumulation .

  • In Chlamydomonas, the Mbb1 protein is essential for psbB mRNA processing and CP47 stability .

Comparative Analysis

CP47 homologs in other species exhibit conserved roles:

SpeciesProtein IDFunction
Cucumis sativusQ2QD63PSII CP47 chlorophyll apoprotein .
Barbarea vernaA4QKD1PSII CP47 homolog with 56.2 kDa mass .

Applications in Photosynthesis Research

  • PSII Assembly Studies: Used to investigate protein-chlorophyll interactions and PSII repair mechanisms .

  • Mutagenesis: Recombinant CP47 enables site-directed mutagenesis to probe chlorophyll-binding residues .

  • Biophysical Analysis: Facilitates spectroscopic studies of energy transfer in PSII .

Limitations and Future Directions

  • Instability Issues: Requires strict storage at -80°C to prevent aggregation .

  • Research Gaps: Limited data on post-translational modifications (e.g., phosphorylation) in D. elephantipes CP47 .

  • Potential Applications: Engineered CP47 variants could optimize photosynthetic efficiency in crops .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWSISGGSITNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGLACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQS INPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVGVGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMP TFFETFPVVLVDVDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPTTVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGAFQKIGDPTTRRQAV
Uniprot No.

Target Background

Function
CP47, a chlorophyll apoprotein, is a key component of the photosystem II (PSII) core complex. It binds chlorophyll and plays a critical role in catalyzing the primary light-induced photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H2O, generating O2 and a proton gradient. This gradient is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What expression systems are suitable for producing recombinant photosynthetic proteins like CP47?

While there is no specific data in the search results about CP47 expression, insights can be drawn from successful recombinant expression of other plant proteins. For photosynthetic proteins, E. coli is often employed as an expression system, though yields may vary. For instance, recombinant dioscorins from Dioscorea species were successfully expressed in E. coli with yields ranging from 4-8 mg/L for some variants to 15-30 mg/L for others . For a complex membrane protein like CP47, specialized expression systems might be necessary, potentially including modifications such as:

  • Codon optimization for the host organism

  • Use of fusion tags to enhance solubility

  • Selection of appropriate E. coli strains optimized for membrane protein expression

  • Temperature optimization during induction phase

  • Addition of molecular chaperones to assist proper folding

How can I verify the structural integrity of recombinant CP47 protein compared to the native form?

Multiple complementary techniques should be employed to verify structural integrity:

  • Circular dichroism (CD) spectroscopy: This can confirm whether the secondary structural content of the recombinant protein matches that of the native protein, as demonstrated with recombinant dioscorins .

  • Western blot analysis: This verifies whether the recombinant protein contains epitopes with similar antigenicities to the native protein .

  • Chemical assays: For instance, determining disulfide bond formation using dithiothreitol (DTT) treatment followed by monobromobimane (mBBr) staining .

  • Functional assays: Testing for known biochemical activities of the protein.

  • Spectroscopic analysis: For chlorophyll-binding proteins like CP47, absorption and fluorescence spectra can verify proper pigment integration.

What computational approaches can determine chlorophyll excitation energies in CP47, and how do they compare with experimental data?

Quantum mechanics/molecular mechanics (QM/MM) approaches have been successfully employed to compute the excitation energies of chlorophyll molecules in CP47. A multiscale approach utilizing full time-dependent density functional theory with modern range-separated functionals can compute the excitation energies of all CP47 chlorophylls in a complete membrane-embedded photosystem II dimer .

This computational approach provides several advantages:

  • Quantification of the electrostatic effect of the protein on the site energies of CP47 chlorophylls

  • High-level quantum chemical excitation profile of CP47 within a complete computational model of "near-native" photosystem II

  • Identification of the most red-shifted chlorophylls (B3, followed by B1), which differs from previous hypotheses in literature

When implementing this approach for Dioscorea elephantipes CP47, researchers should:

  • Begin with a high-resolution structure (X-ray or cryo-EM)

  • Embed the protein in a membrane model

  • Perform molecular dynamics simulations to relax the structure

  • Extract representative frames for QM/MM calculations

  • Apply time-dependent density functional theory to compute excitation energies

How can genomic and chloroplast DNA analysis assist in the cloning of the psbB gene from Dioscorea elephantipes?

Chloroplast genome sequencing provides a valuable foundation for cloning the psbB gene. Based on approaches used for other species, researchers can:

  • Isolate total DNA from Dioscorea elephantipes leaves

  • Use PCR amplification with primers designed based on conserved regions of the psbB gene from related species

  • Confirm the boundaries of inverted repeat (IR) regions, large single-copy (LSC) and small single-copy (SSC) regions of the chloroplast genome using PCR amplification

  • Use online annotation tools like DOGMA (http://dogma.ccbb.utexas.edu/) to identify and annotate the psbB gene

  • Design species-specific primers for the full-length amplification of the psbB gene

  • Clone the amplified product into an appropriate vector for subsequent expression

For primer design, researchers can use the conserved regions identified from alignment of psbB sequences from related species. The position and direction of the gene can be confirmed using reference sequences from related species, such as those from the Magnoliidae clade .

What are the challenges in maintaining protein stability during purification of recombinant CP47, and how can they be addressed?

Maintaining stability during purification of recombinant CP47 presents several challenges:

ChallengeSolution Approach
Maintaining chlorophyll associationInclude glycerol (10-20%) and mild detergents in all buffers
Protein aggregationAdd stabilizing agents like sucrose; perform purification at 4°C
Oxidative damageInclude reducing agents (e.g., DTT, β-mercaptoethanol)
Proteolytic degradationAdd protease inhibitor cocktail; minimize purification time
Loss of structural integrityUse gentle elution conditions; avoid extreme pH values
Detergent selectionScreen various detergents (DDM, OG, LDAO) for optimal solubilization

For recombinant CP47 specifically, maintaining the chlorophyll-protein interactions is critical as their dissociation leads to protein destabilization. The purification protocol should be optimized to preserve these interactions, possibly using approaches similar to those demonstrated effective for other chlorophyll-binding proteins.

How should I design experiments to compare energy transfer efficiency between native and recombinant CP47?

Energy transfer efficiency experiments should include:

  • Sample preparation:

    • Purify both native CP47 (isolated from Dioscorea elephantipes thylakoid membranes) and recombinant CP47

    • Verify protein concentration, purity, and chlorophyll content

    • Prepare samples in identical buffer conditions

  • Spectroscopic measurements:

    • Steady-state absorption and fluorescence spectra

    • Time-resolved fluorescence spectroscopy to determine energy transfer kinetics

    • Fluorescence lifetime measurements

    • Quantum yield determination

  • Data analysis:

    • Calculate energy transfer rates using Förster resonance energy transfer (FRET) theory

    • Compare fluorescence decay components between native and recombinant proteins

    • Analyze spectral features indicative of chlorophyll arrangement and coupling

  • Structural correlations:

    • Relate observed differences to structural variations using computational modeling

    • Identify specific chlorophyll molecules and protein regions responsible for altered energy transfer properties

  • Control experiments:

    • Include measurements at different temperatures to assess conformational flexibility

    • Test stability under varying light conditions

    • Measure energy transfer under different pH conditions

What approaches can determine if the recombinant CP47 maintains proper chlorophyll binding capacity?

To determine chlorophyll binding capacity:

  • Quantitative pigment analysis:

    • Extract chlorophylls using organic solvents

    • Perform HPLC analysis to identify and quantify individual chlorophyll species

    • Calculate chlorophyll-to-protein ratio and compare with native CP47

  • Spectroscopic characterization:

    • Record absorption spectra to identify characteristic peaks of protein-bound chlorophylls

    • Perform circular dichroism spectroscopy in the visible region to assess pigment-protein interactions

    • Use resonance Raman spectroscopy to examine chlorophyll binding environment

  • Binding site mapping:

    • Perform site-directed mutagenesis of predicted chlorophyll-binding residues

    • Assess changes in pigment binding to identify critical amino acids

    • Use computational modeling to predict binding energies

  • Functional correlation:

    • Measure energy transfer efficiency as a function of chlorophyll content

    • Assess the impact of partial chlorophyll extraction on protein stability

    • Compare reconstitution capacity with exogenous chlorophylls

How can I reconcile differences between computational predictions and experimental measurements of CP47 chlorophyll site energies?

Addressing discrepancies between computational and experimental data requires systematic analysis:

  • Identify the source of discrepancies:

    • Compare computational models with different levels of theory and functional choices

    • Evaluate whether differences arise from the protein environment model or the electronic structure method

    • Assess if experimental conditions match computational assumptions

  • Refine computational approaches:

    • Implement more advanced QM/MM methods with range-separated functionals

    • Include explicit solvent molecules in quantum calculations

    • Perform calculations across multiple structural conformations from molecular dynamics

  • Adjust experimental conditions:

    • Control for sample heterogeneity

    • Measure at different temperatures to account for thermal effects

    • Use site-directed mutagenesis to validate specific interactions

  • Interpret within theoretical frameworks:

    • Consider whether differences reflect dynamic processes not captured in static calculations

    • Evaluate whether experimental signals represent ensemble averages versus computational single-state predictions

    • Use sensitivity analysis to identify key parameters driving the discrepancies

When analyzing computationally derived site energies, it's important to note that recent high-level calculations for CP47 have identified different red-shifted chlorophylls (B3, followed by B1) than were previously hypothesized, providing an alternative basis for interpreting experimental data .

What statistical approaches are appropriate for comparing structural stability between isolated CP47 and the protein within intact PSII complexes?

Statistical analysis of structural stability should incorporate:

  • Molecular dynamics simulation analysis:

    • Calculate root mean square deviation (RMSD) and fluctuation (RMSF) values

    • Perform principal component analysis to identify major motions

    • Compare hydrogen bond networks and salt bridge formation

    • Analyze solvent accessible surface area changes

  • Statistical tests and metrics:

    • Use two-sample t-tests or ANOVA for comparing stability parameters

    • Employ non-parametric tests (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data

    • Calculate effect sizes (Cohen's d) to quantify magnitude of differences

    • Apply cluster analysis to group similar structural states

  • Time series analysis:

    • Perform autocorrelation analysis to identify timescales of motion

    • Use Markov state modeling to identify stable conformational states

    • Apply wavelet analysis to identify frequency components of protein motion

  • Correlation with functional data:

    • Calculate Pearson or Spearman correlation coefficients between structural parameters and functional measurements

    • Develop multivariate models to predict functional outcomes from structural features

    • Use machine learning approaches to identify key structural determinants of stability

Molecular dynamics simulations of isolated CP47 can identify which parts of the protein structure remain stable and which regions show increased flexibility when removed from the complete photosystem II complex, providing insights into the structural interdependencies within the larger assembly .

How can recombinant CP47 from Dioscorea elephantipes be used to study evolutionary adaptations in photosynthetic efficiency?

Recombinant CP47 provides a valuable tool for evolutionary studies through:

  • Comparative analysis across species:

    • Express CP47 from multiple Dioscorea species and other plants

    • Compare energy transfer efficiency, chlorophyll organization, and protein stability

    • Correlate differences with environmental adaptations and evolutionary relationships

  • Ancestral sequence reconstruction:

    • Use phylogenetic analysis to predict ancestral CP47 sequences

    • Express and characterize these reconstructed proteins

    • Track the evolution of key functional residues

  • Domain swapping experiments:

    • Create chimeric proteins with domains from different species

    • Identify regions responsible for species-specific functional adaptations

    • Assess the compatibility of components from divergent evolutionary lineages

  • Site-directed mutagenesis studies:

    • Introduce mutations that recreate evolutionary transitions

    • Measure the functional impact of these changes

    • Test hypotheses about selective pressures on photosynthetic proteins

  • Ecological correlations:

    • Relate CP47 properties to habitat-specific light conditions

    • Compare samples from plants growing in different light environments

    • Assess how CP47 variations contribute to species distribution

The chloroplast genome organization, including the psbB gene, can vary across related species, with differences in inverted repeat (IR) regions and gene boundaries that reflect evolutionary adaptations .

What functional assays can determine if recombinant CP47 is suitable for reconstitution experiments with other PSII components?

Functional assessment for reconstitution compatibility requires:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.