The Recombinant Dioscorea elephantipes Photosystem II CP47 Chlorophyll Apoprotein (psbB) is a full-length, His-tagged protein expressed in E. coli for research applications. It corresponds to the UniProt entry A6MMN3 (1–508 amino acids) and is critical for photosynthesis as a core component of Photosystem II (PSII), where it stabilizes chlorophyll molecules and facilitates light absorption . This recombinant protein is produced to study PSII assembly, chlorophyll-protein interactions, and photosynthetic mechanisms in plants .
Domains: Contains six transmembrane helices with large extrinsic loops that bind chlorophyll a and β-carotene .
CP47 (psbB gene product) acts as an inner antenna in PSII, transferring energy from light-harvesting complexes to the PSII reaction center .
Stabilizes chlorophyll a and facilitates the assembly of the oxygen-evolving complex (OEC) .
Requires chlorophyll binding for structural stability; degradation occurs in chlorophyll-deficient environments .
The N-terminal His-tagged sequence begins with:
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM... .
CP47 stability is directly linked to chlorophyll a or Zn-pheophytin a binding. Zn-pheophytin a stabilizes CP47 more efficiently than chlorophyll a at lower concentrations .
In vitro studies show that chlorophyll binding reduces proteolytic degradation of CP47 by up to 90% .
The RNA-binding protein HCF107 stabilizes psbB mRNA and promotes CP47 synthesis in Arabidopsis. Mutants lacking HCF107 show reduced CP47 accumulation .
In Chlamydomonas, the Mbb1 protein is essential for psbB mRNA processing and CP47 stability .
CP47 homologs in other species exhibit conserved roles:
| Species | Protein ID | Function |
|---|---|---|
| Cucumis sativus | Q2QD63 | PSII CP47 chlorophyll apoprotein . |
| Barbarea verna | A4QKD1 | PSII CP47 homolog with 56.2 kDa mass . |
PSII Assembly Studies: Used to investigate protein-chlorophyll interactions and PSII repair mechanisms .
Mutagenesis: Recombinant CP47 enables site-directed mutagenesis to probe chlorophyll-binding residues .
Biophysical Analysis: Facilitates spectroscopic studies of energy transfer in PSII .
While there is no specific data in the search results about CP47 expression, insights can be drawn from successful recombinant expression of other plant proteins. For photosynthetic proteins, E. coli is often employed as an expression system, though yields may vary. For instance, recombinant dioscorins from Dioscorea species were successfully expressed in E. coli with yields ranging from 4-8 mg/L for some variants to 15-30 mg/L for others . For a complex membrane protein like CP47, specialized expression systems might be necessary, potentially including modifications such as:
Codon optimization for the host organism
Use of fusion tags to enhance solubility
Selection of appropriate E. coli strains optimized for membrane protein expression
Temperature optimization during induction phase
Addition of molecular chaperones to assist proper folding
Multiple complementary techniques should be employed to verify structural integrity:
Circular dichroism (CD) spectroscopy: This can confirm whether the secondary structural content of the recombinant protein matches that of the native protein, as demonstrated with recombinant dioscorins .
Western blot analysis: This verifies whether the recombinant protein contains epitopes with similar antigenicities to the native protein .
Chemical assays: For instance, determining disulfide bond formation using dithiothreitol (DTT) treatment followed by monobromobimane (mBBr) staining .
Functional assays: Testing for known biochemical activities of the protein.
Spectroscopic analysis: For chlorophyll-binding proteins like CP47, absorption and fluorescence spectra can verify proper pigment integration.
Quantum mechanics/molecular mechanics (QM/MM) approaches have been successfully employed to compute the excitation energies of chlorophyll molecules in CP47. A multiscale approach utilizing full time-dependent density functional theory with modern range-separated functionals can compute the excitation energies of all CP47 chlorophylls in a complete membrane-embedded photosystem II dimer .
This computational approach provides several advantages:
Quantification of the electrostatic effect of the protein on the site energies of CP47 chlorophylls
High-level quantum chemical excitation profile of CP47 within a complete computational model of "near-native" photosystem II
Identification of the most red-shifted chlorophylls (B3, followed by B1), which differs from previous hypotheses in literature
When implementing this approach for Dioscorea elephantipes CP47, researchers should:
Begin with a high-resolution structure (X-ray or cryo-EM)
Embed the protein in a membrane model
Perform molecular dynamics simulations to relax the structure
Extract representative frames for QM/MM calculations
Apply time-dependent density functional theory to compute excitation energies
Chloroplast genome sequencing provides a valuable foundation for cloning the psbB gene. Based on approaches used for other species, researchers can:
Isolate total DNA from Dioscorea elephantipes leaves
Use PCR amplification with primers designed based on conserved regions of the psbB gene from related species
Confirm the boundaries of inverted repeat (IR) regions, large single-copy (LSC) and small single-copy (SSC) regions of the chloroplast genome using PCR amplification
Use online annotation tools like DOGMA (http://dogma.ccbb.utexas.edu/) to identify and annotate the psbB gene
Design species-specific primers for the full-length amplification of the psbB gene
Clone the amplified product into an appropriate vector for subsequent expression
For primer design, researchers can use the conserved regions identified from alignment of psbB sequences from related species. The position and direction of the gene can be confirmed using reference sequences from related species, such as those from the Magnoliidae clade .
Maintaining stability during purification of recombinant CP47 presents several challenges:
| Challenge | Solution Approach |
|---|---|
| Maintaining chlorophyll association | Include glycerol (10-20%) and mild detergents in all buffers |
| Protein aggregation | Add stabilizing agents like sucrose; perform purification at 4°C |
| Oxidative damage | Include reducing agents (e.g., DTT, β-mercaptoethanol) |
| Proteolytic degradation | Add protease inhibitor cocktail; minimize purification time |
| Loss of structural integrity | Use gentle elution conditions; avoid extreme pH values |
| Detergent selection | Screen various detergents (DDM, OG, LDAO) for optimal solubilization |
For recombinant CP47 specifically, maintaining the chlorophyll-protein interactions is critical as their dissociation leads to protein destabilization. The purification protocol should be optimized to preserve these interactions, possibly using approaches similar to those demonstrated effective for other chlorophyll-binding proteins.
Energy transfer efficiency experiments should include:
Sample preparation:
Purify both native CP47 (isolated from Dioscorea elephantipes thylakoid membranes) and recombinant CP47
Verify protein concentration, purity, and chlorophyll content
Prepare samples in identical buffer conditions
Spectroscopic measurements:
Steady-state absorption and fluorescence spectra
Time-resolved fluorescence spectroscopy to determine energy transfer kinetics
Fluorescence lifetime measurements
Quantum yield determination
Data analysis:
Calculate energy transfer rates using Förster resonance energy transfer (FRET) theory
Compare fluorescence decay components between native and recombinant proteins
Analyze spectral features indicative of chlorophyll arrangement and coupling
Structural correlations:
Control experiments:
Include measurements at different temperatures to assess conformational flexibility
Test stability under varying light conditions
Measure energy transfer under different pH conditions
To determine chlorophyll binding capacity:
Quantitative pigment analysis:
Extract chlorophylls using organic solvents
Perform HPLC analysis to identify and quantify individual chlorophyll species
Calculate chlorophyll-to-protein ratio and compare with native CP47
Spectroscopic characterization:
Record absorption spectra to identify characteristic peaks of protein-bound chlorophylls
Perform circular dichroism spectroscopy in the visible region to assess pigment-protein interactions
Use resonance Raman spectroscopy to examine chlorophyll binding environment
Binding site mapping:
Perform site-directed mutagenesis of predicted chlorophyll-binding residues
Assess changes in pigment binding to identify critical amino acids
Use computational modeling to predict binding energies
Functional correlation:
Measure energy transfer efficiency as a function of chlorophyll content
Assess the impact of partial chlorophyll extraction on protein stability
Compare reconstitution capacity with exogenous chlorophylls
Addressing discrepancies between computational and experimental data requires systematic analysis:
Identify the source of discrepancies:
Compare computational models with different levels of theory and functional choices
Evaluate whether differences arise from the protein environment model or the electronic structure method
Assess if experimental conditions match computational assumptions
Refine computational approaches:
Adjust experimental conditions:
Control for sample heterogeneity
Measure at different temperatures to account for thermal effects
Use site-directed mutagenesis to validate specific interactions
Interpret within theoretical frameworks:
Consider whether differences reflect dynamic processes not captured in static calculations
Evaluate whether experimental signals represent ensemble averages versus computational single-state predictions
Use sensitivity analysis to identify key parameters driving the discrepancies
When analyzing computationally derived site energies, it's important to note that recent high-level calculations for CP47 have identified different red-shifted chlorophylls (B3, followed by B1) than were previously hypothesized, providing an alternative basis for interpreting experimental data .
Statistical analysis of structural stability should incorporate:
Molecular dynamics simulation analysis:
Calculate root mean square deviation (RMSD) and fluctuation (RMSF) values
Perform principal component analysis to identify major motions
Compare hydrogen bond networks and salt bridge formation
Analyze solvent accessible surface area changes
Statistical tests and metrics:
Use two-sample t-tests or ANOVA for comparing stability parameters
Employ non-parametric tests (Mann-Whitney, Kruskal-Wallis) for non-normally distributed data
Calculate effect sizes (Cohen's d) to quantify magnitude of differences
Apply cluster analysis to group similar structural states
Time series analysis:
Perform autocorrelation analysis to identify timescales of motion
Use Markov state modeling to identify stable conformational states
Apply wavelet analysis to identify frequency components of protein motion
Correlation with functional data:
Calculate Pearson or Spearman correlation coefficients between structural parameters and functional measurements
Develop multivariate models to predict functional outcomes from structural features
Use machine learning approaches to identify key structural determinants of stability
Molecular dynamics simulations of isolated CP47 can identify which parts of the protein structure remain stable and which regions show increased flexibility when removed from the complete photosystem II complex, providing insights into the structural interdependencies within the larger assembly .
Recombinant CP47 provides a valuable tool for evolutionary studies through:
Comparative analysis across species:
Express CP47 from multiple Dioscorea species and other plants
Compare energy transfer efficiency, chlorophyll organization, and protein stability
Correlate differences with environmental adaptations and evolutionary relationships
Ancestral sequence reconstruction:
Use phylogenetic analysis to predict ancestral CP47 sequences
Express and characterize these reconstructed proteins
Track the evolution of key functional residues
Domain swapping experiments:
Create chimeric proteins with domains from different species
Identify regions responsible for species-specific functional adaptations
Assess the compatibility of components from divergent evolutionary lineages
Site-directed mutagenesis studies:
Introduce mutations that recreate evolutionary transitions
Measure the functional impact of these changes
Test hypotheses about selective pressures on photosynthetic proteins
Ecological correlations:
Relate CP47 properties to habitat-specific light conditions
Compare samples from plants growing in different light environments
Assess how CP47 variations contribute to species distribution
The chloroplast genome organization, including the psbB gene, can vary across related species, with differences in inverted repeat (IR) regions and gene boundaries that reflect evolutionary adaptations .
Functional assessment for reconstitution compatibility requires: