Recombinant Dioscorea elephantipes Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Dioscorea elephantipes Photosystem Q(B) Protein

The Recombinant Dioscorea elephantipes Photosystem Q(B) protein is a heterologously expressed version of the native Photosystem II (PSII) reaction center protein D1 (PsbA) isolated from Dioscorea elephantipes. This transmembrane protein plays a critical role in the light-dependent reactions of photosynthesis, specifically in electron transfer and quinone binding at the Q(B) site .

Critical domains:

  • Stromal loop (Ile219–Leu272): Contains the Q(B) binding site, including conserved residues like Ala251 .

  • Transmembrane helices: Five helices anchor the protein in the thylakoid membrane .

Recombinant Production

The protein is expressed in E. coli with:

ParameterDetail
TagHis-tag (for affinity purification)
Purity>90% (SDS-PAGE validated)
Yield50 µg (standard; other quantities available)
Storage-20°C or -80°C; avoid repeated freeze-thaw cycles

Sequence alignment:
The Dioscorea elephantipes D1 sequence (A6MMI8) shares ~15% homology with cyanobacterial D1 proteins but retains conserved Q(B) binding residues .

Mutational Studies

Substitutions in the Q(B) binding site alter electron transfer efficiency and protein stability:

Mutation SiteSubstituted ResidueEffectSource
Ala251Arg, Asp, Gln, Glu, HisNonphotosynthetic; loss of Q(B) binding
Ala251Cys, Ser, Pro, Gly, Ile, Val, LeuReduced QA→Q(B) electron transfer; elevated D1 turnover
Ser264Gly, AlaHerbicide resistance; destabilized Q(B)−; accelerated D1 degradation
Phe255Tyr, LeuSimilar to Ser264 mutations

Key observations:

  • Q(B) binding affinity correlates with amino acid bulkiness (e.g., Ala251→Leu reduces binding) .

  • D1 turnover is light-dependent and linked to Q(B)− destabilization .

Comparative Recombinant Proteins

SpeciesUniprot IDLength (aa)TagExpression System
Dioscorea elephantipesA6MMI8344HisE. coli
Prochlorococcus marinusA8G5N5345HisE. coli
Prorocentrum micansQ9TM72343HisE. coli

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Dioscorea elephantipes (Elephant's foot yam) (Testudinaria elephantipes)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFLLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function

Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for ATP synthesis. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does the Photosystem Q(B) protein function in the photosynthetic electron transport chain?

The Photosystem Q(B) protein plays a crucial role in the light-driven water/plastoquinone photooxidoreductase mechanism. It contains the binding site for QB, the secondary quinone acceptor in Photosystem II (PSII), which receives electrons from the primary quinone acceptor (QA) . This electron transfer is fundamental to the photosynthetic process.

The functional pathway operates as follows:

  • After photoexcitation, electrons from the reaction center are transferred to QA

  • QA reduces QB to form the semiquinone QB- −

  • A second electron transfer reduces QB- − further, coupled with protonation, to form QBH2 (plastohydroquinone)

  • QBH2 is then released into the membrane plastoquinone pool

  • A new plastoquinone molecule from the membrane binds to the QB site, continuing the cycle

The midpoint potentials for these reactions have been measured as approximately:

  • E(QB/QB- −) ≈ 90 mV

  • E(QB- −/QBH2) ≈ 40 mV

These thermodynamic properties ensure that the semiquinone QB- − is relatively stable, minimizing back-reactions and electron leakage to oxygen .

What genomic characteristics of Dioscorea elephantipes are relevant for Photosystem Q(B) protein research?

The chloroplast genome of Dioscorea elephantipes contains genes encoding components of the photosynthetic apparatus, including the Photosystem Q(B) protein. Comprehensive analyses of Dioscorea chloroplast genomes have identified various repeat structures that may influence gene expression and regulation. Specifically, D. elephantipes contains two tandem repeats in its chloroplast genome, which is fewer compared to other Dioscorea species .

The chloroplast genome architecture includes:

  • Large Single Copy (LSC) region

  • Small Single Copy (SSC) region

  • Two Inverted Repeat (IR) regions

The photosystem genes may contain introns, with genes like clpP and ycf3 containing two introns while others typically have single introns. The rps12 gene is particularly interesting as it undergoes trans-splicing, with its first exon located in the LSC region and the second and third exons in the IR regions . Understanding these genomic features is essential for designing expression systems for recombinant Photosystem Q(B) protein.

What cultivation conditions affect Dioscorea elephantipes growth for photosynthesis studies?

Dioscorea elephantipes (Elephant's foot) requires specific cultivation conditions that reflect its natural habitat in South Africa (Cape Province). These conditions significantly impact photosynthetic performance and, consequently, Photosystem Q(B) protein expression and function.

Optimal cultivation parameters include:

For research purposes, controlling these variables allows for standardization of plant material used in photosynthetic studies, ensuring consistent Photosystem Q(B) protein expression and function.

What spectroscopic methods are used to study Photosystem Q(B) protein function?

Several spectroscopic techniques provide valuable insights into Photosystem Q(B) protein function:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Directly measures the formation and stability of the semiquinone QB- −

    • Allows determination of midpoint potentials for the QB/QB- − and QB- −/QBH2 redox couples

    • Provides information about the protein environment surrounding the QB site

  • Chlorophyll Fluorescence Spectroscopy:

    • Measures maximal PSII quantum efficiency

    • Quantifies linear electron flow (LEF)

    • Assesses energy-dependent exciton quenching (qE) and photoinhibitory quenching (qI)

    • Determines the relative redox status of QA (qL) during illumination

  • Electrochromic Shift (ECS) measurements:

    • Evaluates the relative extent of steady-state proton motive force (pmf)

    • Measures the conductivity of ATP synthase to protons

    • Connects QB function to broader photosynthetic processes

  • Thermoluminescence:

    • Provides functional estimates of the energy gap between QA- − and QB

    • Allows assessment of charge recombination pathways in Photosystem II

These techniques, when used in combination, provide comprehensive insights into how the Photosystem Q(B) protein functions within the electron transport chain and responds to various experimental conditions.

How do the redox properties of QB in Photosystem II affect electron transfer efficiency and photoinhibition?

The redox properties of QB in Photosystem II critically influence both electron transfer efficiency and photoinhibition susceptibility. Recent research has clarified these relationships with important implications for understanding photosynthetic regulation.

The midpoint potentials of QB redox couples have been measured as:

These values reveal several key insights:

These redox properties collectively optimize Photosystem II function by balancing efficient forward electron transport with minimized back-reactions and photodamage risk.

What experimental approaches are optimal for measuring QB redox potentials in recombinant Photosystem Q(B) proteins?

Accurate measurement of QB redox potentials in recombinant Photosystem Q(B) proteins requires sophisticated experimental approaches that can distinguish between the different redox states while maintaining the protein in a functional state.

The most effective methodological approaches include:

  • Electron Paramagnetic Resonance (EPR) Spectroscopy:

    • Directly measures the formation and stability of the semiquinone QB- −

    • Can be performed at various ambient potentials to determine midpoint potentials

    • Requires careful sample preparation to preserve the native protein environment

    • Cryogenic temperatures are typically used to trap intermediates

  • Redox Potentiometry coupled with spectroscopic detection:

    • Uses redox mediators to establish defined ambient potentials

    • Changes in absorbance, fluorescence, or EPR signals are monitored as a function of potential

    • Enables construction of Nernst plots to determine midpoint potentials

    • Requires careful selection of appropriate mediators to avoid interference

  • Thermoluminescence measurements:

    • Provides functional estimates of redox potential differences

    • Allows assessment of the energy gap between QA- − and QB

    • Temperature-dependent measurements provide thermodynamic information

    • Less direct than EPR but offers complementary information

Experimental considerations for accurate measurements include:

  • Maintaining the recombinant protein in a native-like membrane environment or using suitable detergents that preserve quinone binding sites

  • Controlling pH carefully, as protonation events are coupled to electron transfer

  • Using appropriate redox mediators that can equilibrate with the buried QB site without disrupting protein structure

  • Performing measurements under anaerobic conditions to prevent interference from oxygen

  • Validating results using multiple independent techniques to ensure consistency

The combination of these approaches provides the most reliable determination of QB redox potentials in recombinant Photosystem Q(B) proteins.

How can site-directed mutagenesis be applied to study structure-function relationships in Photosystem Q(B) protein?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in the Photosystem Q(B) protein. This technique enables researchers to systematically alter specific amino acid residues and observe the resulting effects on protein function, stability, and interactions.

Key residues for targeted mutagenesis include:

  • Quinone-binding pocket residues:

    • Amino acids that directly coordinate the QB molecule

    • Residues involved in proton transfer pathways to QB

    • Amino acids that influence the redox potential of QB

  • Transmembrane domain residues:

    • Residues that determine membrane topology and stability

    • Amino acids involved in interactions with other PSII subunits

    • Residues that influence protein flexibility and dynamics

  • Proton channel residues:

    • Amino acids involved in proton uptake from the stromal side

    • Residues forming water networks for proton transfer

    • Amino acids that modulate pKa values of key protonatable groups

Methodological approach for site-directed mutagenesis studies:

  • Expression system selection:

    • Recombinant expression in heterologous systems like E. coli

    • Chloroplast transformation for in vivo studies

    • Use of thylakoid lumen targeting signals for proper localization

  • Mutagenesis strategy:

    • Conservative mutations to probe subtle effects (e.g., D→E, I→L)

    • Non-conservative mutations to drastically alter properties (e.g., D→A, H→A)

    • Alanine-scanning mutagenesis for systematic structure-function mapping

  • Functional characterization:

    • EPR spectroscopy to assess QB redox properties

    • Chlorophyll fluorescence to measure electron transfer kinetics

    • Thermoluminescence to evaluate charge recombination pathways

    • Binding affinity measurements for plastoquinone

  • Structural analysis:

    • Circular dichroism to assess secondary structure changes

    • Crystallography or cryo-EM for direct structural visualization

    • Molecular dynamics simulations to understand dynamic effects

This systematic approach allows researchers to establish direct links between specific amino acid residues and the functional properties of the Photosystem Q(B) protein, advancing our understanding of photosynthetic electron transport and potentially informing the design of artificial photosynthetic systems.

Expression Systems:

  • Bacterial Expression (E. coli):

    • Advantages: High yield, rapid growth, genetic tractability

    • Challenges: Membrane protein folding, lack of post-translational modifications

    • Optimization strategies:

      • Use of specialized strains (e.g., C41(DE3), C43(DE3)) for membrane proteins

      • Codon optimization for D. elephantipes sequences

      • Lower induction temperatures (16-20°C) to improve folding

      • Fusion tags to enhance solubility (e.g., MBP, SUMO)

  • Microalgal Expression Systems:

    • Advantages: Native-like thylakoid environment, post-translational modifications

    • Implementation strategy:

      • Utilize bacterial export signals to target recombinant proteins to the thylakoid lumen

      • Design appropriate promoters for regulated expression

      • Optimize growth conditions for maximum biomass and protein yield

  • Plant Expression Systems:

    • Advantages: Native post-translational modifications, native-like membrane environment

    • Approaches:

      • Transient expression in Nicotiana benthamiana

      • Stable transformation of model plants

      • Chloroplast transformation for direct expression in the target organelle

Purification Strategies:

  • Detergent Solubilization:

    • Initial screening of detergents (DDM, LMNG, etc.) for optimal extraction

    • Use of mixed detergent systems to maintain protein stability

    • Addition of lipids during purification to maintain native-like environment

  • Affinity Chromatography:

    • Incorporation of affinity tags (e.g., His6, Strep-tag II)

    • Tag placement optimization to maintain protein function

    • Mild elution conditions to preserve protein structure

  • Size Exclusion Chromatography:

    • Separation of properly folded protein from aggregates

    • Assessment of oligomeric state

    • Buffer optimization for long-term stability

Protein Quality Assessment:

  • Functional Assays:

    • Electron transfer activity measurements

    • Binding affinity for plastoquinone

    • EPR spectroscopy to verify correct semiquinone formation

  • Structural Integrity:

    • Circular dichroism to verify secondary structure

    • Thermal stability assays

    • Limited proteolysis to assess proper folding

By combining these methodological approaches and carefully optimizing each step, researchers can obtain functional recombinant Photosystem Q(B) protein suitable for structural and functional studies.

How does proton motive force affect Photosystem II function and QB redox state in vivo?

Proton motive force (pmf) plays a critical regulatory role in modulating Photosystem II function and QB redox state in vivo. Recent research has revealed complex relationships between pmf, electron transport, and photoinhibition that have significant implications for understanding photosynthetic regulation.

The proton motive force affects Photosystem II function through several mechanisms:

Research using mutant lines with altered pmf (minira lines) has demonstrated that photoinhibition cannot be explained solely by QA reduction state, suggesting alternative mechanisms. One proposed model involves effects on PSII recombination rates mediated by pmf-induced changes in electron transfer kinetics .

Experimental approaches to study these relationships include:

  • In vivo spectroscopic measurements of maximal PSII quantum efficiency

  • Assessment of linear electron flow (LEF)

  • Quantification of energy-dependent exciton quenching (qE)

  • Measurement of photoinhibitory quenching (qI) using saturation pulse chlorophyll a fluorescence

These studies employ red actinic illumination to prevent incorrect assessment of chloroplast movement as qI, as red light is ineffective in inducing chloroplast movements. Additionally, a Stern-Volmer derivation of qE (qE(SV)) is used to minimize the contribution of qI in the determination of qE .

Understanding these complex relationships provides insights into the regulatory mechanisms that balance photosynthetic efficiency with photoprotection in natural environments with fluctuating light conditions.

What experimental design is optimal for studying QB redox changes under variable light conditions?

Designing experiments to study QB redox changes under variable light conditions requires careful consideration of methodological approaches that can capture the dynamic nature of photosynthetic electron transport while maintaining physiological relevance.

Comprehensive Experimental Design:

  • Plant Material Preparation:

    • Use standardized growth conditions for Dioscorea elephantipes or model organisms

    • Ensure plants are at similar developmental stages

    • Consider including mutants with altered electron transport (if available)

    • For in vitro studies, prepare thylakoid membranes or PSII particles under dim green light to prevent photodamage

  • Light Regime Design:

    • Implement programmed light fluctuations that mimic natural conditions:

      • Sinusoidal patterns to simulate daily changes

      • Step changes to examine rapid responses

      • Fluctuating patterns with defined frequencies to probe regulatory mechanisms

    • Example protocol: Start at low intensity (e.g., 39 μmol photons m⁻² s⁻¹), gradually increase to peak intensities (e.g., 500-1000 μmol photons m⁻² s⁻¹), then decrease following the same pattern

  • Measurement Techniques:

    • Chlorophyll fluorescence imaging:

      • Capture sequences of images (e.g., 15 frames with 60 ms delay)

      • Include pre-, during, and post-saturation flash measurements

      • Analyze using software (e.g., ImageJ) modified for fluorescence parameter calculations

    • EPR spectroscopy for direct QB- ⁻ detection

    • Electrochromic shift (ECS) measurements to assess proton motive force

  • Inhibitor Studies:

    • Use specific electron transport inhibitors to isolate QB effects:

      • DCMU to block electron transfer from QA to QB

      • Inhibitors of cytochrome b6f to manipulate plastoquinone pool redox state

    • Protein synthesis inhibitors to distinguish damage from repair:

      • Lincomycin (3 mM) to inhibit chloroplast protein translation

      • Pre-incubate excised leaves in dark for 3 hours before light treatments

  • Data Acquisition and Analysis:

    • Measure steady-state values for NPQ parameters prior to changing light intensity

    • Calculate parameters including:

      • Relative QA redox status (qL)

      • Energy-dependent quenching (qE)

      • Photoinhibitory quenching (qI)

    • Perform statistical analysis to identify significant relationships between parameters

    • Use ANOVA to assess interaction effects between factors (e.g., light intensity, qE, qL)

This comprehensive experimental design allows researchers to systematically investigate the dynamic changes in QB redox state under variable light conditions and to understand how these changes relate to broader photosynthetic regulation and photoprotection mechanisms.

How can chloroplast genome analysis contribute to understanding Photosystem Q(B) evolution?

Chloroplast genome analysis provides valuable insights into the evolutionary history and functional adaptations of the Photosystem Q(B) protein across plant lineages. An effective research strategy combines comparative genomics, molecular evolution analysis, and structure-function correlations.

Methodological Framework:

  • Comparative Genomics Approach:

    • Sequence acquisition and alignment:

      • Extract psbA gene sequences (encoding Photosystem Q(B) protein) from chloroplast genomes

      • Perform multiple sequence alignments using tools like MUSCLE or MAFFT

      • Include diverse plant lineages with emphasis on Dioscorea species

    • Genomic context analysis:

      • Examine gene order and synteny around psbA

      • Identify repeat structures that may influence gene expression

      • Analyze the 275 repeats identified across nine Dioscorea chloroplast genomes, including dispersed, palindromic, and tandem repeats

    • Intron analysis:

      • Compare intron presence/absence patterns across lineages

      • Examine trans-splicing patterns (as seen in rps12)

  • Molecular Evolution Analysis:

    • Selection pressure analysis:

      • Calculate dN/dS ratios to identify sites under positive, neutral, or purifying selection

      • Test for episodic selection using branch-site models

    • Amino acid property analysis:

      • Identify conserved vs. variable regions

      • Correlate with functional domains (quinone binding, proton channels)

    • Phylogenetic reconstruction:

      • Build gene trees for psbA and compare with species trees

      • Identify potential horizontal gene transfer events

  • Structure-Function Correlation:

    • Homology modeling:

      • Generate structural models of Photosystem Q(B) proteins from different lineages

      • Compare QB binding pocket architecture

    • Mutational sensitivity mapping:

      • Identify positions where mutations are rarely tolerated across evolution

      • Correlate with experimental mutagenesis data

    • Coevolution analysis:

      • Detect coevolving residues that may form functional networks

      • Relate to known electron and proton transfer pathways

  • Experimental Validation Strategies:

    • Recombinant expression of ancestral or divergent Photosystem Q(B) variants

    • Functional characterization of QB binding and electron transfer properties

    • Site-directed mutagenesis to test evolutionary hypotheses

This integrated approach allows researchers to reconstruct the evolutionary history of Photosystem Q(B) protein, identify key adaptive changes across plant lineages, and understand how structural and functional properties have been shaped by evolutionary processes.

What are the comparative differences between Photosystem Q(B) proteins across different plant species?

Comparative analysis of Photosystem Q(B) proteins across different plant species reveals both highly conserved functional domains and species-specific adaptations that reflect evolutionary pressures and environmental niches.

Functional Implications:

Comparative analysis suggests that variations in Photosystem Q(B) proteins may contribute to species-specific photosynthetic characteristics:

Methodological Approaches for Comparative Studies:

  • Sequence-based analysis:

    • Multiple sequence alignments across diverse lineages

    • Identification of conserved motifs and variable regions

    • Correlation with functional domains and structural features

  • Structural comparison:

    • Homology modeling based on available crystal structures

    • Analysis of QB binding pocket geometry

    • Comparison of electrostatic surface properties

  • Experimental validation:

    • Heterologous expression of Photosystem Q(B) proteins from different species

    • Functional characterization using spectroscopic methods

    • Chimeric proteins to identify domains responsible for species-specific properties

This comparative approach provides insights into both the fundamental mechanisms of photosynthetic electron transport and the evolutionary adaptations that enable plants to thrive in diverse environments.

How can recombinant Photosystem Q(B) protein be incorporated into artificial photosynthetic systems?

Incorporating recombinant Photosystem Q(B) protein into artificial photosynthetic systems represents an innovative approach for developing biomimetic energy conversion technologies. This integration requires careful consideration of protein stability, functional coupling, and system architecture.

Methodological Framework:

  • Protein Preparation and Modification:

    • Expression optimization:

      • Select appropriate expression systems (bacterial, algal, or plant-based)

      • Use targeting sequences to ensure proper folding and membrane insertion

      • The bacterial export signal approach demonstrated for thylakoid lumen targeting in microalgae could be adapted for Photosystem Q(B) protein

    • Stability enhancement:

      • Introduce stabilizing mutations identified through evolutionary analysis

      • Incorporate unnatural amino acids for enhanced stability

      • Design fusion proteins with stability-enhancing domains

    • Interface engineering:

      • Modify surface residues to facilitate integration with artificial components

      • Add attachment sites for immobilization on electrodes or nanostructures

      • Preserve the QB binding pocket and electron transfer pathways

  • Membrane Mimetic Systems:

    • Liposome incorporation:

      • Reconstitute Photosystem Q(B) protein in liposomes with controlled lipid composition

      • Optimize protein-to-lipid ratios for functional stability

      • Include additional photosynthetic components for electron transfer coupling

    • Polymer-based membranes:

      • Develop block copolymer membranes with appropriate hydrophobicity profiles

      • Engineer membrane thickness to accommodate Photosystem Q(B) protein

      • Incorporate ion channels for proton equilibration

    • Solid-state interfaces:

      • Design peptide tethers for oriented protein attachment to electrodes

      • Develop conductive hydrogels to facilitate electron transfer

      • Create microenvironments that mimic thylakoid lumen conditions

  • Electron Transfer Coupling:

    • Artificial reaction centers:

      • Design synthetic chromophores to replace natural chlorophylls

      • Optimize energy transfer to Photosystem Q(B) protein

      • Engineer spectral response for improved solar spectrum utilization

    • Electron acceptor systems:

      • Develop synthetic acceptors to replace the natural plastoquinone pool

      • Engineer redox potentials for efficient electron harvesting

      • Create pathways for regeneration of oxidized acceptors

    • Complete electron transport chains:

      • Incorporate multiple photosynthetic components in defined arrangements

      • Control spatial organization to optimize electron transfer kinetics

      • Design proton circuits for coupled proton and electron transfer

  • Performance Evaluation:

    • Electron transfer kinetics:

      • Transient absorption spectroscopy to measure electron transfer rates

      • Electrochemical methods to quantify current generation

      • Long-term stability assessment under continuous illumination

    • Quantum efficiency:

      • Determine incident photon-to-current efficiency (IPCE)

      • Measure absorbed photon-to-current efficiency (APCE)

      • Compare with natural photosynthetic efficiency

    • System integration:

      • Couple artificial photosynthetic systems to catalysts for fuel production

      • Develop scalable architectures for practical applications

      • Evaluate performance under real-world conditions

By systematically addressing these challenges, researchers can harness the sophisticated electron transfer properties of Photosystem Q(B) protein for developing next-generation solar energy conversion technologies that combine the efficiency of natural photosynthesis with the durability of synthetic materials.

What are the key research priorities for advancing our understanding of Recombinant Dioscorea elephantipes Photosystem Q(B) protein?

Understanding the Recombinant Dioscorea elephantipes Photosystem Q(B) protein requires a multidisciplinary approach spanning structural biology, biochemistry, biophysics, and synthetic biology. Several research priorities emerge from current knowledge and technological capabilities.

First, high-resolution structural studies are needed to elucidate the precise architecture of the QB binding pocket in Dioscorea elephantipes. While the amino acid sequence is known , and the functional properties have been characterized in related systems , species-specific structural features remain to be determined. Cryo-electron microscopy and X-ray crystallography of the recombinant protein would provide valuable insights into the molecular basis of electron transfer.

Second, comparative redox potential measurements between Dioscorea elephantipes and model organisms are essential. The midpoint potentials determined for Photosystem II from Thermosynechococcus elongatus (E(QB/QB- −) ≈ 90 mV and E(QB- −/QBH2) ≈ 40 mV) provide a reference point, but species-specific variations could reveal evolutionary adaptations to different environmental conditions.

Third, developing improved expression and purification protocols specifically optimized for Dioscorea elephantipes Photosystem Q(B) protein is crucial. The thylakoid lumen targeting approaches demonstrated in microalgae could be adapted for this specific protein, potentially improving yield and functionality of the recombinant protein.

Fourth, integrating genomic, structural, and functional studies would provide a comprehensive understanding of this protein. The chloroplast genome characteristics of Dioscorea elephantipes, including the identified repeat structures , should be correlated with protein expression and function to understand regulatory mechanisms.

Finally, applied research exploring the incorporation of this protein into artificial photosynthetic systems represents an exciting frontier. The unique properties of Photosystem Q(B) protein, particularly its ability to stabilize the semiquinone intermediate , could be valuable for developing bio-inspired energy conversion technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.