Recombinant Dipeptide transport system permease protein dppB (dppB)

Shipped with Ice Packs
In Stock

Description

Introduction to DppB

DppB is a critical component of the bacterial ATP-binding cassette (ABC) transporter system DppBCDF, primarily responsible for dipeptide uptake. Recombinant DppB refers to the engineered production of this protein through heterologous expression systems, enabling structural and functional studies. Native to Escherichia coli and other Gram-negative bacteria, DppB functions as a transmembrane permease, facilitating substrate translocation across the inner membrane .

Substrate Transport Mechanism

DppB operates in a conformational cycle driven by ATP hydrolysis:

  1. Substrate binding: SBP (e.g., DppA) binds dipeptides in the periplasm.

  2. Conformational change: ATP binding induces DppD to adopt a closed configuration, triggering TMH rearrangements in DppB/C to open the periplasmic cavity .

  3. Translocation: Substrate release into the cytoplasm via the TMH channel.

Table 2: Functional Roles of DppB in Transport

RoleMechanismEvidence
Substrate channelingTMH1/2 form a hydrophobic cavity for dipeptide passage
ATP-dependent gatingCoupling with DppD ATPase activity to regulate transport direction
Heme/ALA transportUtilizes alternative SBPs (MppA) for heme precursor uptake

Mutational Studies

  • Scoop motif deletion: Δscoop-motif variants show reduced ATPase activity (25% of wild-type) and impaired growth under dipeptide stress, indicating a role in sealing the substrate cavity .

  • Arg42/Asp445 mutations: Disruption of DppB-DppA interactions (e.g., R42A/E41A) abolishes substrate transport but retains partial ATPase activity .

Interactions and Network Analysis

DppB interacts with multiple proteins in the DppBCDF system and beyond:

Table 3: Protein Interaction Network of DppB

InteractorRoleInteraction StrengthSource
DppCTMD partner for dipeptide translocation0.999
DppDATPase subunit for energy coupling0.999
DppASBP for substrate delivery0.977
OppCOligopeptide permease0.998

Applications and Pathological Relevance

  • Nutritional transport: Critical for bacterial growth on peptide-rich environments (e.g., gut microbiota) .

  • Pathogen virulence: In Helicobacter pylori, DppB mutants show altered virulence factor expression and enhanced IL-8 induction in host cells .

  • Antibiotic target: Structural insights into DppB-TMH dynamics could inform the design of ABC transporter inhibitors .

Future Directions

  1. Cryo-EM studies: High-resolution structures of DppB in complex with diverse substrates (e.g., heme, tripeptides).

  2. Therapeutic development: Exploiting DppB as a target for antimicrobials in pathogens like Mycobacterium tuberculosis .

  3. Biotechnological use: Engineering DppB for enhanced peptide uptake in industrial strains.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
dppB; Z4960; ECs4423; Dipeptide transport system permease protein DppB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
dppB
Target Protein Sequence
MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGISPERHAQLLAELGLDK PMWQQYLHYIWGVMHGDLGISMKSRIPVWEEFVPRFQATLELGVCAMIFATAVGIPVGVL AAVKRGSIFDHTAVGLALTGYSMPIFWWGMMLIMLVSVHWNLTPVSGRVSDMVFLDDSNP LTGFMLIDTAIWGEDGNFIDAVAHMILPAIVLGTIPLAVIVRMTRSSMLEVLGEDYIRTA RAKGLTRMRVIIVHALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQR RDYPVVQGGVLLVATMIILVNLLVDLLYGVVNPRIRHKK
Uniprot No.

Target Background

Function
This protein, a component of the ABC transporter DppABCDF, plays a role in dipeptide transport. It facilitates the translocation of the substrate across the membrane.
Database Links

KEGG: ece:Z4960

STRING: 155864.Z4960

Protein Families
Binding-protein-dependent transport system permease family, OppBC subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the dipeptide transport system permease protein DppB and what is its functional role?

DppB is one of the two integral membrane proteins (along with DppC) that form the translocation pathway for dipeptide substrates in the Dpp (dipeptide permease) transporter system. This system is primarily found in Gram-negative bacteria like Escherichia coli. As a key component of the DppABCDF complex, DppB facilitates the transport of dipeptides from the periplasmic space into the bacterial cytoplasm .

The complete Dpp transporter consists of five distinct subunits with specialized functions:

  • DppA: A periplasm-localized substrate-binding protein (SBP) for capturing dipeptide substrates

  • DppB and DppC: Integral membrane proteins forming the translocation pathway

  • DppD and DppF: ATPases that bind and hydrolyze ATP to drive transport

DppB specifically contributes to the formation of the transmembrane channel through which dipeptides pass, playing an essential role in nutrient acquisition for bacterial cells .

How does the DppB protein's structure support its transport function?

Recent cryo-electron microscopy (cryo-EM) studies have revealed that DppB contains a unique structural feature called the "scoop motif" (an α1-loop-α2 motif) that extends into the periplasmic space. This distinctive structural element plays a crucial role in ensuring efficient dipeptide transport across the membrane .

The scoop motif forms specific interactions with the substrate-binding protein DppA and the transported dipeptide. In particular, residues E41 and R42 in the scoop loop of DppB form salt bridges with residues R383 and D436 of DppA, which are themselves involved in dipeptide capture through charge-charge interactions with the carboxyl and amino groups of the bound dipeptide .

This structural arrangement serves a dual purpose:

  • Preventing dipeptide substrates from binding back-and-forth to DppA after release

  • Creating a sealed outward-facing substrate cavity that prevents dipeptides from escaping into the periplasm upon release from DppA

What experimental systems are available for expressing recombinant DppB?

Recombinant expression of membrane proteins like DppB presents significant challenges due to their hydrophobic nature and complex folding requirements. E. coli remains the most commonly used organism for recombinant protein production in research laboratories, offering several advantages for DppB expression .

For functional studies of DppB, researchers typically express the entire DppABCDF complex rather than DppB alone, as the protein functions as part of this multisubunit assembly. Expression can be achieved using specialized E. coli strains and vectors designed for membrane protein production .

Key considerations for recombinant DppB expression include:

  • Selection of appropriate E. coli expression strains

  • Optimization of induction conditions (temperature, inducer concentration)

  • Use of fusion tags to facilitate proper folding and purification

  • Membrane extraction using suitable detergents

What is the significance of the "scoop motif" in DppB and how can it be experimentally investigated?

The scoop motif in DppB represents a specialized structural feature that plays a critical role in the dipeptide transport mechanism. Research has shown that this motif prevents dipeptides from escaping into the periplasm and avoids futile back-and-forth binding to DppA after substrate release .

Experimental approaches to investigate the scoop motif include:

  • Site-directed mutagenesis: Targeting key residues in the scoop motif (E41A, R42A) disrupts the salt bridge interactions with DppA. Bacterial complementation experiments with these mutants have demonstrated impaired growth, confirming the functional importance of these interactions .

  • Deletion studies: Complete removal of the scoop motif (DppB Δscoop-motif) significantly impairs dipeptide transport and reduces ATPase activity to approximately one-fourth of wild-type levels, suggesting its essential role in forming a sealed outward-facing substrate cavity .

  • ATPase activity assays: These provide quantitative measurement of transporter function. Data from such experiments show that:

DppABCDF VariantRelative ATPase Activity (%)
Wild-type DppABCDF100
DppAB E41A+R42ACDF~50
DppAB Δscoop-motifCDF~25
DppA R383D+D436RBCDF<10

These results highlight the critical nature of the scoop motif in maintaining efficient transport function .

What are the conformational changes in DppB during the dipeptide transport cycle?

DppB undergoes significant conformational changes during the transport cycle as part of the DppABCDF complex. Cryo-EM structural studies have revealed distinct conformational states of the transporter, providing insights into the dynamic nature of the transport process .

Key conformational states and changes include:

  • Resting state (inward-facing): In the absence of ATP and DppA, the DppBCDF translocator adopts an inward-facing conformation with the substrate translocation pathway open to the cytoplasm but sealed from the periplasm. In this state, the DppB scoop motif is positioned away from DppA .

  • ATP-bound DppBCDF (still inward-facing): Interestingly, binding of ATP analogs (ATPγS or AMPPNP) to the DppBCDF translocator alone does not induce significant conformational changes. The translocator remains in an inward-facing conformation with only one ATP analog molecule bound to DppF .

  • Pre-catalytic state (outward-facing): Concurrent binding of DppA and ATP causes a dramatic conformational change to an outward-facing state. In this conformation, two ATP molecules bind at the interface between DppD and DppF, and the DppB scoop motif engages with DppA. These interactions create a sealed outward-facing cavity into which dipeptide substrates are released from DppA .

  • Post-hydrolysis state (returning to inward-facing): Following ATP hydrolysis, the transporter reverts to an inward-facing conformation, completing the transport cycle and releasing the dipeptide into the cytoplasm .

These conformational changes highlight the sophisticated allosteric communication between the various components of the DppABCDF complex during transport.

How can recombinant DppB be expressed and purified for structural studies?

Expression and purification of recombinant DppB for structural studies presents considerable challenges due to its hydrophobic nature and requirement for proper membrane integration. Successful strategies typically involve expressing DppB as part of the entire DppBCDF translocator or DppABCDF complex rather than in isolation .

A methodological approach for recombinant DppB expression and purification includes:

  • Construct design:

    • Cloning the dppB gene into expression vectors with appropriate fusion tags (His-tag, FLAG-tag)

    • Including the complete dppBCDF operon to maintain proper stoichiometry

    • Considering codon optimization for improved expression in E. coli

  • Expression optimization:

    • Using specialized E. coli strains designed for membrane protein expression

    • Testing different growth media and induction conditions

    • Optimizing temperature, inducer concentration, and expression duration

  • Membrane extraction and solubilization:

    • Carefully selecting detergents for membrane solubilization (commonly DDM, LMNG)

    • Screening detergent concentrations to maintain protein stability and function

    • Adding stabilizers such as glycerol or specific lipids

  • Purification strategy:

    • Employing affinity chromatography as an initial purification step

    • Following with size exclusion chromatography to ensure homogeneity

    • Verifying protein quality through functional assays (e.g., ATPase activity)

For structural studies specifically, recent advances in cryo-EM have enabled researchers to determine the structure of the DppBCDF translocator and DppABCDF complex without the need for protein crystallization, which has traditionally been challenging for membrane proteins .

How does ATP binding and hydrolysis influence the function of DppB within the Dpp transporter complex?

The DppBCDF translocator demonstrates a unique relationship with ATP binding and hydrolysis that differs from many other ABC transporters. Key insights from recent research include:

  • ATP binding alone is insufficient: Unlike some ABC transporters, binding of ATP or non-hydrolyzable ATP analogs (ATPγS, AMPPNP) to the DppBCDF translocator alone does not induce significant conformational changes. The translocator remains in an inward-facing conformation with only one ATP molecule bound to the DppF subunit .

  • DppA is required for ATP hydrolysis: The DppBCDF translocator itself lacks significant ATPase activity. Enzymatic assays have demonstrated that activation of ATPase function requires the concurrent binding of the substrate-binding protein DppA .

  • Synergistic effects of ATP and DppA: When both ATP and DppA bind to DppBCDF, the transporter undergoes a dramatic conformational change to an outward-facing state. In this pre-catalytic conformation, two ATP molecules bind at the interface between the DppD and DppF ATPase domains .

  • Prevention of futile ATP hydrolysis: This requirement for DppA binding prevents wasteful ATP consumption in the absence of substrate, representing an elegant regulatory mechanism for the transporter .

Experimental data supporting these findings include ATPase activity assays demonstrating that:

  • DppBCDF alone shows negligible ATPase activity

  • Addition of DppA significantly enhances ATP hydrolysis

  • Further addition of dipeptide substrates maximizes ATPase activity

This coupling between DppA binding, ATP hydrolysis, and conformational changes in DppB represents a sophisticated mechanism ensuring that energy expenditure occurs only when substrate transport is possible.

What are the key differences between DppB in Gram-negative bacteria compared to homologous proteins in other bacterial systems?

These differences highlight evolutionary adaptations to different cellular architectures and environmental conditions, with important implications for antibiotic development targeting these transport systems.

What experimental approaches are most effective for studying DppB-substrate interactions?

Investigating the interactions between DppB and dipeptide substrates requires sophisticated experimental approaches due to the complex nature of the transport process. Effective methodologies include:

  • Structural biology techniques:

    • Cryo-electron microscopy (cryo-EM) has emerged as a powerful tool for studying the DppABCDF complex in different conformational states, providing insights into substrate interactions with the transporter .

    • X-ray crystallography, although challenging with membrane proteins, can provide high-resolution structural information when successful.

  • Functional assays:

    • ATPase activity measurements provide quantitative data on transporter function in response to substrates.

    • Transport assays using radiolabeled or fluorescently labeled dipeptides can directly measure substrate translocation.

    • Bacterial complementation experiments using Δdpp strains grown on dipeptide-containing media provide in vivo functional assessment .

  • Biophysical interaction studies:

    • Surface plasmon resonance (SPR) can measure binding kinetics between purified DppB (as part of the DppBCDF complex) and dipeptide substrates.

    • Microscale thermophoresis (MST) offers an alternative approach for quantifying interactions in solution.

  • Mutagenesis approaches:

    • Site-directed mutagenesis targeting residues in DppB predicted to interact with substrates

    • Analysis of conservation patterns across bacterial species to identify functionally important regions

    • Creation of chimeric proteins to map domain-specific functions

For example, mutagenesis studies focusing on the scoop motif of DppB have provided valuable insights into its role in dipeptide transport. Mutations in key residues (E41A+R42A) disrupt interactions with DppA and reduce transport efficiency, while complete deletion of the scoop motif severely impairs function .

What are the latest advances in understanding the role of DppB in antibiotic uptake and resistance?

Recent research has highlighted the potential significance of the Dpp transport system, including DppB, in antibiotic uptake and resistance mechanisms. While the primary physiological role of the system is nutritional (dipeptide uptake), its involvement in drug transport has important implications for antimicrobial therapy:

  • Antibiotic uptake: Several naturally occurring peptide antibiotics may utilize the Dpp transport system as an entry route into bacterial cells. The structural insights into DppB and the complete DppABCDF complex provide a foundation for understanding how these antimicrobial compounds interact with the transporter .

  • Potential drug targets: The essential nature of dipeptide transport for bacterial growth under certain conditions makes the Dpp system, including DppB, a potential target for novel antimicrobial development. Inhibitors designed to disrupt the DppB scoop motif interaction with DppA could potentially interfere with bacterial nutrient acquisition .

  • Resistance mechanisms: Mutations in components of the Dpp system could potentially contribute to resistance against peptide antibiotics that utilize this transport pathway. Understanding the structure-function relationships of DppB and related proteins may help predict and counteract such resistance mechanisms.

  • Species-specific differences: The structural and functional differences between Dpp transporters in different bacterial species (e.g., E. coli versus M. tuberculosis) may be exploited for the development of species-selective antimicrobial strategies .

Future research in this area will likely focus on identifying specific antibiotics that utilize the Dpp system for cellular entry and developing targeted approaches to enhance antibiotic delivery or overcome resistance mechanisms.

How can structural information about DppB be used to engineer improved recombinant expression systems?

The detailed structural information now available for DppB as part of the DppBCDF and DppABCDF complexes offers opportunities to engineer improved expression systems for this challenging membrane protein:

  • Stabilizing mutations: Based on structural analysis, specific mutations can be introduced to enhance protein stability without compromising function. Focus areas might include:

    • Interface residues between DppB and other complex components

    • Regions with high conformational flexibility

    • Solvent-exposed hydrophobic patches

  • Fusion protein design: Strategic design of fusion proteins based on structural data can improve expression and purification:

    • N- or C-terminal fusions that don't interfere with critical functional domains

    • Internal fusion partners at permissive sites identified from structural analysis

    • Removable tags positioned to minimize disruption of protein folding

  • Co-expression strategies: The structural understanding of DppB's interactions within the complete DppABCDF complex suggests that co-expression of multiple components may enhance stability and proper folding:

    • Co-expression with DppC, its direct interaction partner

    • Expression of the complete DppBCDF translocator

    • Development of optimized expression vectors with appropriate stoichiometry of components

  • Lipid environment optimization: Structural details about DppB's membrane interactions can guide the selection of optimal lipid compositions for expression and purification:

    • Identification of specific lipid requirements based on native interactions

    • Development of customized detergent or nanodisc systems that mimic the native membrane environment

E. coli remains the preferred expression system for recombinant protein production in research laboratories, offering adaptability for membrane protein expression through careful optimization of expression conditions . The combination of structural insights with advances in expression technology provides promising avenues for improving the recombinant production of DppB for fundamental research and potential biotechnological applications.

What are the common pitfalls in recombinant DppB expression and how can they be addressed?

Recombinant expression of membrane proteins like DppB presents several challenges that researchers frequently encounter. Here are common issues and potential solutions:

  • Low expression levels:

    • Problem: Membrane proteins often express poorly due to toxicity, improper folding, or degradation.

    • Solutions:

      • Use tightly controlled expression systems with tunable promoters

      • Test multiple E. coli strains specialized for membrane protein expression

      • Optimize growth temperature (often lowering to 18-25°C improves yield)

      • Consider co-expression with chaperones or other Dpp complex components

  • Protein aggregation:

    • Problem: Improper folding leads to inclusion body formation or aggregation.

    • Solutions:

      • Express as fusion with solubility-enhancing partners

      • Optimize induction conditions (lower IPTG concentration, slower induction)

      • Consider expressing DppB as part of the native DppBCDF complex

      • Explore refolding protocols if inclusion bodies form

  • Extraction difficulties:

    • Problem: Inefficient extraction from the membrane.

    • Solutions:

      • Screen multiple detergents (DDM, LMNG, digitonin) for optimal extraction

      • Test detergent concentration gradients

      • Add stabilizing agents (glycerol, specific lipids) during extraction

      • Consider native nanodiscs or styrene maleic acid copolymer (SMA) for extraction

  • Functional instability:

    • Problem: Loss of function during purification.

    • Solutions:

      • Minimize exposure to harsh conditions

      • Include dipeptide substrates or ATP analogs during purification

      • Maintain specific lipids throughout the purification process

      • Verify functional integrity through ATPase assays at multiple purification stages

  • Co-expression challenges:

    • Problem: Imbalanced expression of DppB relative to other complex components.

    • Solutions:

      • Design polycistronic constructs with optimized translation efficiency for each component

      • Use separate plasmids with compatible origins of replication

      • Adjust induction conditions to achieve proper stoichiometry

      • Consider sequential induction strategies

For example, recent structural studies of the DppABCDF complex successfully addressed many of these challenges by expressing the complete translocator and using cryo-EM for structural characterization, avoiding the need for crystallization .

How can researchers troubleshoot issues with DppB function in experimental systems?

When investigating DppB function within experimental systems, researchers may encounter various functional issues that require systematic troubleshooting approaches:

  • Lack of ATPase activity:

    • Issue: The purified DppBCDF complex shows no detectable ATPase activity.

    • Troubleshooting:

      • Verify that all components (DppB, C, D, F) are present in the complex

      • Add purified DppA, as the translocator alone lacks significant activity

      • Ensure ATP and necessary metal cofactors (typically Mg²⁺) are present

      • Check if detergents used during purification inhibit activity

  • Impaired dipeptide transport:

    • Issue: Expected dipeptide transport is not observed in complementation or transport assays.

    • Troubleshooting:

      • Verify expression of all five components of the DppABCDF system

      • Ensure the integrity of the DppB scoop motif, as mutations here significantly impair function

      • Test multiple dipeptide substrates, as specificity may vary

      • Analyze ATP binding and hydrolysis capability

  • Aberrant conformational states:

    • Issue: The transporter fails to undergo expected conformational changes.

    • Troubleshooting:

      • Verify the simultaneous presence of DppA and ATP, which are both required for the transition to the outward-facing state

      • Check protein integrity through analytical techniques (size exclusion chromatography, SDS-PAGE)

      • Consider possible oxidation of the [4Fe-4S] clusters in the ATPase domains

      • Evaluate detergent effects on conformational flexibility

  • Bacterial growth defects in complementation assays:

    • Issue: Complementation with recombinant DppB fails to restore growth of Δdpp strains.

    • Troubleshooting:

      • Verify expression levels and proper membrane localization

      • Check for potential dominant-negative effects from fusion tags

      • Test complementation under various substrate concentrations

      • Consider alternative nitrogen sources if using the standard Gly-Leu dipeptide medium

  • Protein-protein interaction failures:

    • Issue: Expected interactions between DppB and other complex components are not detected.

    • Troubleshooting:

      • Ensure proper protein folding and membrane integration

      • Test interaction under different nucleotide states (apo, ATP-bound, ADP-bound)

      • Evaluate detergent interference with protein interfaces

      • Consider crosslinking approaches to stabilize transient interactions

Systematic application of these troubleshooting approaches, combined with appropriate controls, can help identify and resolve issues affecting DppB function in experimental systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.