Recombinant Diplodus annularis Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Introduction to Rhodopsin and Diplodus annularis

Rhodopsins are photoreceptive membrane proteins consisting of a common heptahelical transmembrane architecture that contains a retinal chromophore. Rhodopsin was first discovered in the animal retina in 1876, but recent genomic and metagenomic analyses have revealed more than 9000 animal rhodopsins with diverse functionality and tremendous new applications . These proteins function as the primary photoreceptors in rod cells, responsible for vision in low-light conditions.

Diplodus annularis, commonly known as the annular seabream, is a marine fish species belonging to the Sparidae family that inhabits the Mediterranean Sea and eastern Atlantic Ocean . The rhodopsin protein from this species has become an important model for studying visual systems in marine vertebrates. Like other animal rhodopsins, the Diplodus annularis rhodopsin belongs to the G protein-coupled receptor superfamily and plays a crucial role in the visual transduction cascade.

Expression and Purification Systems

Recombinant Diplodus annularis Rhodopsin can be produced in various expression systems, each offering distinct advantages for research applications. The table below summarizes the available expression platforms:

Expression SystemCharacteristicsProduct Code ExampleReference
E. coliHigh yield, relatively simple, may require refoldingCSB-EP019681DAAC1
YeastEukaryotic post-translational modifications, membrane protein foldingCSB-YP019681DAAC1
BaculovirusEnhanced expression of complex membrane proteinsCSB-BP019681DAAC1
MammalianNative-like processing and foldingCSB-MP019681DAAC1

Commercial preparations of recombinant Diplodus annularis Rhodopsin are typically provided with affinity tags such as His-tags to facilitate purification . Various suppliers offer these proteins with different specifications to meet research needs.

Evolutionary Rate Variation Across Structure

Research examining the evolutionary patterns of rhodopsin has revealed that mutation rates vary significantly across different structural regions of the protein. Notably, residues exposed to the lipid bilayer show higher rates of evolution compared to those facing the protein interior or involved in critical functional interactions .

A Fourier analysis of amino acid substitution patterns across transmembrane helices revealed that variability was biased toward the lipid-facing surfaces of the helices rather than the protein core. Six of seven transmembrane helices showed a strong positive surface index for amino acid differences, indicating that residues exposed to the membrane environment evolve more rapidly than buried residues . This pattern reflects the reduced functional constraints on surface-exposed residues compared to those involved in maintaining the core structure or function of the protein.

Applications in Research and Biotechnology

Recombinant Diplodus annularis Rhodopsin has several important applications in scientific research:

Evolutionary and Comparative Studies

Rhodopsin sequences provide valuable data for studying the evolution of visual systems across species. Studies analyzing rhodopsin variability have revealed important insights into the relationship between protein structure and evolutionary rate . These analyses demonstrate that amino acid substitutions in rhodopsin are not randomly distributed but follow patterns influenced by structural constraints, particularly in transmembrane regions.

The differentiation of rhodopsin sequences across populations and species can be quantified using statistics like FST, which measures genetic differentiation. This approach has been used to identify loci showing unusually high or low levels of differentiation, potentially indicating natural selection . Such evolutionary analyses help researchers understand how visual systems adapt to different light environments.

Gene Therapy Research

Rhodopsin is the most frequently mutated gene in autosomal dominant retinitis pigmentosa (ADRP), a hereditary disorder causing photoreceptor degeneration . Research has demonstrated that gene delivery of wild-type rhodopsin can rescue retinal function in animal models of ADRP, suggesting potential therapeutic approaches for human patients .

In a notable study, adeno-associated virus (AAV) mediated gene delivery of wild-type rhodopsin rescued retinal function in mice expressing a P23H mutant human rhodopsin transgene. Analysis of the full-field scotopic electroretinogram demonstrated that increased expression of rhodopsin slowed the rate of retinal degeneration, with increased amplitudes in both a-wave and b-wave compared to control eyes . This finding indicates that wild-type rhodopsin could rescue retinal degeneration in transgenic mice carrying a dominant rhodopsin mutation and that increased production of normal rhodopsin could suppress the effect of the mutant protein.

Metabolic Studies

Recent research has indicated that rhodopsin plays a significant role in cellular energy metabolism. Studies have shown that overexpression of rhodopsin or its mutants can lead to energy failure in photoreceptor cells . This energy failure represents an early event in cell death caused by rhodopsin overexpression and might contribute to the pathogenesis of retinal degenerative diseases.

Research comparing the effects of wild-type rhodopsin and various mutants (P23H, R135L, and G188R) revealed that rhodopsin overexpression leads to oxidative phosphorylation deficiency, potentially resulting from mitochondrial loss . These findings suggest that different rhodopsin missense mutations have distinct impacts on energy metabolic pathways, which might be related to their heterogeneous phenotypes in disease.

Optogenetic Applications

Rhodopsins have become important tools in optogenetics, a technique that uses light to control genetically modified cells . While microbial rhodopsins are more commonly used in these applications, animal rhodopsins like that from Diplodus annularis may offer unique properties for specific research applications, particularly when investigating visual processing mechanisms.

Future Research Directions

Research on Diplodus annularis rhodopsin continues to expand our understanding of visual systems and their evolution. Several promising areas for future research include:

Structure-Function Relationships

Detailed structural studies comparing rhodopsins from different species can provide insights into how specific amino acid substitutions influence functional properties. One particular area of interest is understanding how substitutions at specific positions, such as position 83, can alter spectral properties of rhodopsin, with different variants producing shifts in absorption spectra that may represent adaptations to various light environments .

Novel Therapeutic Approaches

Insights gained from studying diverse rhodopsins may inform the development of gene therapy approaches for treating retinal degenerative diseases. The success of wild-type rhodopsin supplementation in rescuing retinal function in animal models suggests potential therapeutic strategies for human patients with rhodopsin-related retinal disorders .

Protein Engineering

Understanding the structure-function relationships in rhodopsins may enable the design of engineered variants with novel properties for biotechnological applications. The detailed amino acid sequence and structural knowledge of Diplodus annularis rhodopsin provides a foundation for such engineering efforts.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Diplodus annularis (Annular seabream) (Sparus annularis)
Target Names
rho
Target Protein Sequence
MNGTEGPFFYVPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVLGGFTTTMYTSMHGYFVLGRLGCNIEGFFATLG GEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGLAFTWTMAMACAAPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFICHFTIPLTVVFFCYGRLLCAVKEAAAAQQES ETTQRAEKEVTRMVIMMVIAFLVCWLPYASVAWYIFTHQGSEFGPVFMTIPAFFAKSSSI YNPMIYICLNKQFRHCMITTLCCGKNPFEEEEGASTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function

Recombinant Diplodus annularis Rhodopsin (rho) is a photoreceptor crucial for low-light vision. While retinal serves as the chromophore in most saltwater fish, freshwater species frequently utilize 3-dehydroretinal, or a combination of both. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling via G-proteins. Subsequent receptor phosphorylation, mediated by arrestin, displaces the bound G-protein alpha subunit, terminating the signal transduction pathway.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

How does D. annularis Rhodopsin compare with rhodopsins from other fish species?

When comparing rhodopsins across fish species, researchers should consider both sequence homology and functional adaptations to different aquatic environments. D. annularis Rhodopsin shows the characteristic pattern of saltwater fish species in predominantly using retinal as a chromophore, whereas most freshwater fish species utilize 3-dehydroretinal or a mixture of both .

Phylogenetic analysis often employs rhodopsin gene sequences alongside other markers such as mitochondrial 16S rRNA, cytochrome b, and additional genetic markers to establish evolutionary relationships among fish species . This approach has been valuable in taxonomic studies of Sparidae family members, to which D. annularis belongs.

Important comparative considerations include:

FeatureSaltwater Fish Rhodopsins (e.g., D. annularis)Freshwater Fish Rhodopsins
Primary chromophoreRetinal3-dehydroretinal
Spectral absorptionTypically shifted toward blue wavelengthsOften shifted toward red wavelengths
AdaptationOptimized for marine environmentsOptimized for freshwater environments

Research methodologies for comparative analysis should include sequence alignment, phylogenetic tree construction, and spectroscopic analysis to identify functional adaptations related to different aquatic habitats.

What expression systems are most effective for recombinant D. annularis Rhodopsin production?

Selecting an appropriate expression system is critical for obtaining functional recombinant D. annularis Rhodopsin. Several expression systems can be considered, each with distinct advantages:

Methodological approach:

  • Begin with codon optimization for your chosen expression system

  • Design constructs with appropriate tags for detection and purification (His-tag, FLAG-tag)

  • Consider fusion partners that enhance expression and solubility

  • Include appropriate signal sequences for membrane targeting

  • Implement inducible promoter systems for controlled expression

The choice of expression system should be guided by experimental objectives – structural studies may prioritize quantity and purity, while functional studies require proper folding and native-like behavior .

What purification strategies yield highest activity for recombinant D. annularis Rhodopsin?

Purification of functional recombinant rhodopsin requires careful consideration of its membrane protein nature and light sensitivity. A comprehensive purification protocol typically involves:

  • Membrane preparation: After cell lysis, differential centrifugation separates membranes containing the recombinant protein.

  • Solubilization: Select detergents carefully – mild detergents like n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG) preserve rhodopsin functionality better than harsher detergents.

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged constructs

    • Size exclusion chromatography to remove aggregates and ensure monodispersity

    • Optional ion exchange chromatography for further purification

  • Critical considerations:

    • Conduct all procedures under dim red light or in darkness to prevent photobleaching

    • Maintain low temperature (4°C) throughout purification

    • Include appropriate protease inhibitors to prevent degradation

    • Consider including stabilizing agents like glycerol or specific lipids

Purification StepKey ParametersQuality Control
Membrane isolationLow temperature, protease inhibitorsWestern blot verification
Detergent solubilization1-2% detergent, 2-4 hours at 4°CSolubilization efficiency
IMAC purificationImidazole gradient (10-250 mM)SDS-PAGE, A280/A500 ratio
Size exclusionFlow rate ≤0.5 mL/minMonodispersity by DLS

Researcher should verify protein functionality through spectroscopic assays examining the characteristic absorbance peak of properly folded rhodopsin with bound chromophore .

How can the photoactivation properties of recombinant D. annularis Rhodopsin be characterized?

Characterizing the photoactivation properties of recombinant D. annularis Rhodopsin requires multiple complementary approaches to assess both structural changes and functional outcomes:

  • UV-Visible Spectroscopy: The primary method to monitor rhodopsin activation. Dark-adapted rhodopsin shows an absorbance peak at approximately 500 nm, which shifts upon light exposure as 11-cis retinal isomerizes to all-trans. Time-resolved spectroscopy can capture the photointermediates in the activation process.

  • Fluorescence Spectroscopy: Measures changes in intrinsic tryptophan fluorescence upon photoactivation, providing insight into conformational changes.

  • FTIR Spectroscopy: Reveals specific structural changes during photoactivation by detecting alterations in protein vibrations.

  • G-protein Activation Assays:

    • GTPγS binding assays measure the rate of nucleotide exchange on G-proteins

    • Bioluminescence resonance energy transfer (BRET) assays monitor rhodopsin-G-protein interactions in real-time

  • Electrophysiological Measurements: In cell-based systems, patch-clamp recordings can measure downstream channel activities triggered by rhodopsin activation.

Methodological workflow should include:

  • Preparation of dark-adapted samples under dim red light

  • Controlled light exposure with specific wavelengths and intensities

  • Time-resolved measurements to capture activation kinetics

  • Temperature control (typically 20-25°C)

  • Reconstitution in appropriate lipid environments for native-like behavior

Results should be interpreted by comparison to well-characterized rhodopsin systems to identify unique properties of D. annularis Rhodopsin related to its marine environment adaptation .

What analytical techniques are most informative for structure-function studies of D. annularis Rhodopsin?

Structure-function studies of D. annularis Rhodopsin benefit from multiple analytical approaches:

  • Site-directed Mutagenesis: Systematic mutation of conserved or variable residues to identify those critical for:

    • Chromophore binding

    • G-protein coupling

    • Activation kinetics

    • Spectral tuning

  • Structural Biology Techniques:

    • X-ray crystallography (challenging but provides highest resolution)

    • Cryo-electron microscopy (increasingly powerful for membrane proteins)

    • Solid-state NMR (provides dynamic information)

    • Hydrogen-deuterium exchange mass spectrometry (identifies solvent-accessible regions)

  • Molecular Dynamics Simulations: Computational approach to predict:

    • Protein flexibility and movement

    • Water and ion accessibility

    • Energy landscapes of activation

    • Ligand binding properties

  • Cross-linking Studies: Identify interaction interfaces between:

    • Rhodopsin and G-proteins

    • Rhodopsin dimers or oligomers

    • Rhodopsin and regulatory proteins (e.g., arrestin, kinases)

How can recombinant D. annularis Rhodopsin be utilized in optogenetic applications?

Recombinant D. annularis Rhodopsin presents opportunities for optogenetic applications, particularly given its evolution in marine environments which may confer unique spectral and kinetic properties:

  • Advantages for optogenetics:

    • Natural light-sensitivity without exogenous chromophore addition

    • Potential for spectral tuning through targeted mutations

    • GPCR-based signaling provides access to diverse downstream pathways

  • Methodological approach for optogenetic adaptation:

    • Codon optimization for expression in mammalian neurons

    • Addition of trafficking signals for proper membrane localization

    • Fusion with fluorescent proteins for visualization

    • Creation of chimeric proteins with specific G-protein coupling domains

  • Characterization workflow:

    • In vitro spectroscopic analysis to determine activation wavelengths

    • Cell-based assays to verify signaling outputs

    • Slice electrophysiology to test neuronal activation/inhibition

    • In vivo behavioral testing in model organisms

  • Potential research applications:

    • Manipulation of GPCR signaling pathways with spatial and temporal precision

    • Studying vision biology through rhodopsin-based optogenetic tools

    • Developing new tools with spectral properties optimized for tissue penetration

Researchers should systematically compare the properties of native and engineered variants of D. annularis Rhodopsin to other optogenetic tools, documenting activation/deactivation kinetics, light sensitivity, and signaling specificity .

What approaches can address challenges in crystal structure determination of D. annularis Rhodopsin?

Determining the crystal structure of membrane proteins like D. annularis Rhodopsin presents significant challenges. Researchers can employ these methodological strategies:

  • Protein engineering approaches:

    • Truncation of disordered regions (particularly C-terminal tail)

    • Introduction of thermostabilizing mutations

    • Creation of fusion constructs with crystallization chaperones (e.g., T4 lysozyme, BRIL)

    • Antibody fragment co-crystallization to provide crystal contacts

  • Detergent and lipid optimization:

    • Systematic screening of detergents beyond standard options

    • Bicelles and lipidic cubic phase methods for crystallization

    • Nanodiscs and amphipols for maintaining native-like environments

    • Lipid additive screening for stability enhancement

  • Alternative structural approaches:

    • Single-particle cryo-electron microscopy (avoiding crystallization)

    • Solid-state NMR for specific structural elements

    • Hybrid methods combining low-resolution envelope data with computational modeling

  • Crystallization optimization:

    • Automated high-throughput screening of thousands of conditions

    • In situ diffraction screening to identify microcrystals

    • Seeding techniques to improve crystal quality

    • Serial crystallography at X-ray free-electron lasers for microcrystals

Structural ChallengeMethodological SolutionConsiderations
Protein instabilityAlanine scanning for thermostabilizing mutationsMay affect native dynamics
Poor crystal contactsT4 lysozyme or BRIL fusion constructsSelect insertion site carefully
Detergent micelle interferenceLipidic cubic phase crystallizationRequires specialized equipment
Conformational heterogeneityUse of ligands to trap specific statesConsider light-sensitivity during setup

These approaches have proven successful for other rhodopsins and GPCRs and can be adapted for D. annularis Rhodopsin .

How can genomic and evolutionary analysis of D. annularis Rhodopsin inform functional studies?

Genomic and evolutionary analyses provide valuable context for understanding D. annularis Rhodopsin function:

  • Comparative genomic approaches:

    • Sequence alignment across diverse fish species to identify conserved vs. variable regions

    • Analysis of selection pressure (dN/dS ratios) to identify functionally important residues

    • Identification of species-specific adaptations in spectral tuning sites

  • Phylogenetic analysis methodology:

    • Construction of phylogenetic trees using rhodopsin sequences alongside other genetic markers

    • Integration with ecological data to correlate sequence variations with habitat

    • Ancestral sequence reconstruction to understand evolutionary trajectory

  • Functional implications to investigate:

    • Correlation between rhodopsin sequence variations and spectral sensitivity

    • Relationship between habitat depth and specific amino acid substitutions

    • Adaptation patterns between marine and freshwater species

D. annularis Rhodopsin has been used alongside mitochondrial 16S rRNA, cytochrome b, and other genetic markers in phylogenetic studies of Sparidae family members . These evolutionary analyses reveal how visual systems adapt to specific ecological niches and can guide site-directed mutagenesis studies targeting residues with evolutionary significance.

Researchers should consider how D. annularis' environment as a marine sparid has shaped rhodopsin properties compared to freshwater counterparts, particularly regarding chromophore usage and spectral tuning mechanisms .

What are common challenges in recombinant D. annularis Rhodopsin research and their solutions?

Researchers working with recombinant D. annularis Rhodopsin commonly encounter several challenges:

  • Low expression yields:

    • Solution: Optimize codon usage for expression system; screen multiple promoters; test different cell lines; use fusion partners known to enhance GPCR expression (e.g., BRIL, mCherry)

    • Methodology: Implement systematic small-scale expression screening before scaling up

  • Improper folding and chromophore binding:

    • Solution: Add exogenous retinal during expression; lower expression temperature (16-18°C); include chemical chaperones in media

    • Assessment method: Monitor A280/A500 ratio to quantify properly folded protein percentage

  • Protein aggregation during purification:

    • Solution: Screen multiple detergents; include cholesterol or specific lipids; use glycerol as stabilizer

    • Analytical approach: Dynamic light scattering to monitor aggregation state

  • Light sensitivity during handling:

    • Solution: Work under dim red light (>650 nm); use amber laboratory tubes; minimize exposure time

    • Control method: Include non-illuminated samples as controls throughout procedures

  • Functional deterioration during storage:

    • Solution: Store at -80°C in small aliquots; add reducing agents; consider lyophilization protocols

    • Validation: Regular spectroscopic assays to verify functionality of stored samples

ChallengeCommon IndicatorsMethodological SolutionsVerification Approach
Poor foldingHigh A280/A500 ratioReduced temperature, chemical chaperonesCircular dichroism spectroscopy
AggregationCloudy solutions, elution in void volumeDetergent screening, add glycerolSize exclusion chromatography
InstabilityActivity loss over timeOptimize buffer components, reduce oxidationRegular activity assays
PhotobleachingLoss of characteristic absorptionWork under red light, minimize exposureCompare to dark-adapted controls

Researchers should implement systematic troubleshooting protocols, changing only one variable at a time and thoroughly documenting outcomes to develop optimized protocols for their specific experimental setup .

How can contradictory results in D. annularis Rhodopsin studies be reconciled?

When confronting contradictory results in D. annularis Rhodopsin research, investigators should employ a systematic approach:

  • Methodological sources of variation:

    • Expression system differences (bacterial vs. insect vs. mammalian)

    • Purification protocol variations (detergents, buffer components)

    • Experimental conditions (temperature, pH, ionic strength)

    • Light exposure history of samples

  • Analytical reconciliation approach:

    • Direct side-by-side comparison using identical protocols

    • Blind testing to eliminate experimenter bias

    • Multi-laboratory validation of critical findings

    • Development of standard operating procedures for key assays

  • Common sources of discrepancies:

    • Different isoforms or splice variants being studied

    • Post-translational modification variations

    • Presence/absence of interacting proteins

    • Lipid environment differences affecting function

  • Resolution strategy:

    • Comprehensive characterization of starting material (sequencing, mass spectrometry)

    • Systematic variation of experimental parameters to identify critical variables

    • Computational modeling to generate testable hypotheses explaining differences

    • Development of more sensitive or orthogonal analytical methods

Researchers should maintain detailed laboratory records documenting all experimental conditions, reagent sources, and environmental factors that might influence results. When publishing, provide sufficient methodological detail to enable proper replication by other laboratories .

How might D. annularis Rhodopsin research contribute to understanding marine fish visual ecology?

D. annularis Rhodopsin research offers unique insights into marine visual ecology through several research approaches:

  • Comparative spectroscopic analysis:

    • Methodology: Measure absorption spectra of recombinant rhodopsins from multiple marine species

    • Application: Correlate spectral tuning with habitat depth, water clarity, and feeding behavior

    • Experimental design: Express rhodopsins from species occupying different ecological niches

  • Structure-function analysis of marine adaptations:

    • Approach: Identify amino acid substitutions unique to marine species through comparative sequence analysis

    • Methodology: Create site-directed mutants converting marine-specific residues to freshwater variants

    • Measurement: Quantify changes in spectral sensitivity, activation kinetics, and G-protein coupling

  • Integration with ecological data:

    • Research direction: Correlate D. annularis feeding patterns and habitat preferences with rhodopsin properties

    • Approach: Field studies combined with laboratory functional characterization

    • Analysis: Statistical models linking visual protein properties to ecological behaviors

  • Microbiome-visual system interactions:

    • Novel approach: Investigate potential relationships between gill/skin microbiota and visual physiology

    • Methodology: Compare rhodopsin properties in fish with different microbiome compositions

    • Relevance: Building on findings that D. annularis microbiota composition differs between body sites

This research has implications beyond D. annularis, potentially revealing broader patterns of visual adaptation in marine environments and contributing to our understanding of sensory ecology in changing marine ecosystems .

What are the future prospects for using D. annularis Rhodopsin in biotechnology applications?

D. annularis Rhodopsin holds promise for innovative biotechnological applications:

  • Biosensor development:

    • Approach: Engineer rhodopsin-based FRET sensors for detecting environmental parameters

    • Methodology: Create fusion constructs with fluorescent proteins reporting conformational changes

    • Applications: Marine pollutant detection, light quality monitoring in aquatic environments

    • Advantage: Direct optical readout without requiring sample processing

  • Optogenetic tool development:

    • Research direction: Engineer D. annularis Rhodopsin variants with altered spectral sensitivity

    • Methodology: Structure-guided mutagenesis targeting chromophore pocket

    • Application: Expanding optogenetic toolbox with spectrally diverse actuators

    • Advantage: Potentially unique properties derived from marine adaptation

  • Bioinspired materials:

    • Approach: Study rhodopsin light-detection mechanism for synthetic photoreceptor development

    • Methodology: Analyze protein-chromophore interactions through spectroscopy and computational modeling

    • Application: Design of light-responsive materials for environmental monitoring

  • Structural biology platform:

    • Research direction: Develop D. annularis Rhodopsin as a model system for membrane protein studies

    • Methodology: Optimize expression and crystallization protocols

    • Application: Template for studying other challenging membrane proteins

    • Advantage: Relatively small size and established purification methods

Researchers pursuing these applications should implement interdisciplinary approaches, combining protein engineering, spectroscopy, materials science, and computational modeling to maximize the biotechnological potential of this marine visual protein .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.