Recombinant DnaJ homolog dnj-2 (dnj-2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant DnaJ Homolog Dnj-2 (dnj-2)

DnaJ homolog dnj-2 (dj2), is a member of the DnaJ/Hsp40 family of proteins that function as co-chaperones with Hsp70 proteins in various cellular processes, including protein folding and trafficking . In humans, three DnaJ homologs have been identified in the cytosol: dj1 (Hsp40/hdj-1), dj2 (HSDJ/hdj-2), and neuronal tissue-specific hsj1 . Dj2 exhibits the greatest structural similarity to bacterial DnaJ and yeast Ydj1p, possessing a J-domain, G/F-domain, and a cysteine-rich region .

Structure and Function

The structure of dj2 is characterized by several key domains :

  • J-domain: Interacts with Hsp70 proteins.

  • G/F-domain

  • Cysteine-rich region: Coordinates two zinc atoms and is crucial for binding to chemically denatured luciferase.
    Additionally, dj2 has a CaaX prenylation motif at its COOH terminus and undergoes post-translational farnesyl modification .

Dj2 functions as a partner DnaJ for the Hsc70-based chaperone system, being more efficient than dj1 . It plays a role in mitochondrial protein import and the refolding of denatured proteins .

Expression and Localization

Both dj2 and dj3 are farnesylated and ubiquitously expressed . Immunocytochemical and subfractionation studies have shown that these proteins colocalize with Hsc70 under normal conditions . After heat shock, dj1 and Hsc70 colocalize in the nucleoli .

Functional Studies

Research has demonstrated the importance of dj2 in protein folding and mitochondrial protein import . A study using chaperone depletion and re-addition in rabbit reticulocyte lysates found that Hsc70 and dj2, but not dj1, are involved in the mitochondrial import of preornithine transcarbamylase . Dj2, along with Hsc70, can efficiently refold firefly luciferase . Bacterial DnaJ can replace mammalian dj2 in mitochondrial protein import and luciferase refolding, suggesting a conserved chaperone system across species .

Simultaneous depletion of dj2 and dj3 from rabbit reticulocyte lysate significantly reduces mitochondrial import of pre-ornithine transcarbamylase and refolding of guanidine-denatured luciferase . Re-addition of either dj2 or dj3 leads to the recovery of these reactions .

Interactions with Other Proteins

Dj2 interacts with Hsc70, functioning as a co-chaperone in protein folding and trafficking . Anti-apoptotic protein Bag-1 further stimulates ATP hydrolysis and protein refolding by both Hsc70-dj2 and Hsc70-dj3 pairs .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
dnj-2; B0035.2; DnaJ homolog dnj-2; DnaJ domain protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-337
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
dnj-2
Target Protein Sequence
MRSAIAAPILFLLVSFFVQECESVGFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRAL ARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYDYYLDHPDQRFYNYYQYYR LRAAPKVDLRIVIVGTILIISLFQFLSAKHKFSEAIEYATGVGKFRNMAIKDGIDKGLLE MDRNGKLKKNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWT ALWYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKRNCATW KAERDAAEQEKMAQSGRYKRYKRYMKNAGTISFVDED
Uniprot No.

Target Background

Database Links

KEGG: cel:CELE_B0035.2

STRING: 6239.B0035.2

UniGene: Cel.23438

Protein Families
DNAJC25 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is DnaJ homolog dnj-2 and what is its biological function in C. elegans?

    DnaJ homolog dnj-2 is a 39,993 Da protein in Caenorhabditis elegans that belongs to the highly conserved DnaJ/Hsp40 family of cochaperones . Similar to other DnaJ proteins, dnj-2 likely functions in cooperation with heat shock protein 70 (Hsp70) family members to facilitate various cellular processes, including protein folding, intracellular protein trafficking, and protection against proteotoxicity .

    The DnaJ family proteins are characterized by their J-domain, which stimulates the ATPase activity of Hsp70 chaperones . While the specific function of dnj-2 in C. elegans has not been fully characterized in the provided literature, studies on similar DnaJ homologs suggest it plays essential roles in protein quality control mechanisms, which are fundamental for cellular homeostasis and stress response .

  • How do researchers distinguish between different DnaJ homologs in experimental systems?

    Researchers distinguish between DnaJ homologs through several methodological approaches:

    • Sequence analysis: Different DnaJ proteins have distinct domain organizations. For example, many DnaJ subfamily members contain the J-domain, G/F-domain, and cysteine-rich region, while others may have additional domains or structural features .

    • Expression patterns: Using transcriptional reporters (e.g., GFP fusion constructs), researchers can observe tissue-specific and developmental expression patterns .

    • Functional assays: Specific in vitro and in vivo assays can differentiate functions, such as:

      • Mitochondrial protein import assays

      • Protein folding assays using model substrates like luciferase

      • ATPase stimulation assays with partner Hsp70 proteins

    • Mutant phenotyping: Comparing phenotypes of genetic mutants for different DnaJ homologs .

  • What expression systems are used to produce recombinant DnaJ homologs for research?

    Several expression systems are employed for recombinant DnaJ protein production:

    Expression SystemApplicationsNotes
    E. coliHigh-yield expression for structural studies and in vitro assaysUsed for human dj1 expression
    Insect cells (Sf9)Post-translational modifications like farnesylationEnhanced by adding mevalonolactone to medium for dj2
    Cell-free expressionRapid production, avoids toxicity issuesUsed for dnj-2 recombinant protein production

    The choice of expression system depends on research objectives. For basic binding studies, bacterial expression may be sufficient, while studies requiring post-translational modifications may necessitate eukaryotic systems. Purification typically employs affinity tags, such as histidine tags, with subsequent purification using nickel chelate affinity columns .

  • What is the importance of chaperone stoichiometry when working with recombinant DnaJ proteins?

    The relative stoichiometry of DnaJ and Hsp70 proteins is critical for their proper function in protein folding and homeostasis:

    • At optimal ratios, DnaJ and Hsp70 proteins work synergistically to assist protein folding

    • High concentrations of DnaJ can inhibit chaperone-mediated refolding due to competitive binding to substrates

    • Studies revealed that nearly every protein contains multiple DnaK (Hsp70) and DnaJ-binding sites, with DnaJ sites occurring approximately twice as often

    • An "overwhelming majority" of DnaK sites partially or completely overlap with DnaJ-binding motifs, suggesting their binding can be either cooperative or competitive depending on stoichiometry

    When designing experiments with recombinant DnaJ proteins, researchers should carefully titrate the ratios of chaperones and co-chaperones to achieve optimal activity, particularly in protein folding assays .

  • How can I verify the functional activity of purified recombinant dnj-2?

    Several assays can validate the functional activity of purified recombinant dnj-2:

    1. ATPase stimulation assay: Measure the ability of dnj-2 to stimulate the ATPase activity of partner Hsp70 proteins using colorimetric or radioactive ATP hydrolysis assays

    2. Protein folding assays: Test dnj-2's ability to assist in refolding denatured model substrates, such as:

      • Luciferase (monitor recovery of enzymatic activity by luminescence)

      • Malate dehydrogenase (monitor activity spectrophotometrically)

    3. Binding assays: Use techniques like surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure direct interactions with:

      • Hsp70 partner proteins

      • Substrate proteins

      • ATP/ADP

    4. Thermal shift assays: Assess protein stability and ligand binding through differential scanning fluorimetry

    The resulting data should be compared to known active DnaJ homologs as positive controls to benchmark functional activity.

Advanced Research Questions

  • How do DnaJ binding sites on client proteins influence chaperone activity and what methodologies can reveal these interactions?

    DnaJ binding sites on client proteins play a crucial role in determining chaperone activity. Research methodologies to study these interactions include:

    1. Computational prediction approaches:

      • Free energy-based binding consensus motifs can predict DnaJ binding sites

      • For example, sites with ΔΔG binding < -2 kJ/mol represent a binding probability of >80%

      • Studies have generated affinity matrices for DnaJ binding, similar to those for DnaK/Hsp70

    2. Peptide array analysis:

      • Cellulose-bound peptide arrays can identify binding motifs

      • Frequency tables of amino acid preferences at each position help construct binding models

    3. Proteome-wide analyses:

      • Algorithms can scan entire proteomes to predict DnaJ binding sites

      • Studies revealed DnaJ sites occur approximately twice as often as DnaK sites

      • Most DnaJ and DnaK binding sites partially or completely overlap

    4. Structural studies:

      • NMR and X-ray crystallography reveal that "short, hydrophobic peptide sequences bind in a shallow groove in the zinc finger region" of DnaJ proteins

    These analyses revealed that the distribution of predicted binding sites is a good predictor of the optimal chaperone stoichiometry needed for protein folding, with important implications for experimental design when working with recombinant DnaJ proteins .

  • What are the current approaches for studying dnj-2 gene function in C. elegans models?

    Several sophisticated approaches are employed to study dnj-2 and other DnaJ homolog functions in C. elegans:

    1. CRISPR-Cas9 genome editing:

      • Generate precise mutations in the DnaJ domain or other functional regions

      • Create deletion alleles targeting specific domains

      • Introduce reporter tags for visualization

    2. RNAi-mediated gene knockdown:

      • High-throughput screening of phenotypes

      • Tissue-specific knockdown using strain-specific RNAi sensitivity

    3. Transgenic expression systems:

      • Single-copy insertion of wild-type or mutant transgenes

      • Tissue-specific promoters (e.g., myo-3 for muscle expression)

      • Fusion to fluorescent reporters like YFP or GFP for localization studies

    4. Phenotypic analysis:

      • Behavioral assays (e.g., locomotion, response to aldicarb)

      • Lifespan and stress resistance measurements

      • Protein aggregation monitoring in neurodegenerative disease models

    5. Genetic interaction studies:

      • Double mutant analysis with partners like Hsp70 family members

      • Suppressor/enhancer screens to identify functional pathways

    When studying dnj-2 specifically, researchers should consider its potential functional redundancy with other DnaJ family members in C. elegans .

  • How do mutations in the conserved domains of DnaJ proteins affect their function in protein homeostasis?

    Mutations in conserved domains of DnaJ proteins can significantly alter their function in protein homeostasis through several mechanisms:

    1. J-domain mutations:

      • The highly conserved HPD motif in the J-domain is crucial for stimulating Hsp70 ATPase activity

      • Mutations in this region prevent effective interaction with Hsp70 partners

      • For example, in DNJ-17, the N77K mutation in a conserved domain acts as a gain-of-function mutation affecting neuronal circuit function

    2. G/F-domain mutations:

      • The glycine/phenylalanine-rich region assists in stimulating ATPase activity

      • Mutations can impair substrate transfer to Hsp70

    3. Zinc-finger domain mutations:

      • This region is implicated in binding unfolded peptides

      • The cysteine-rich region coordinates zinc atoms and is important for binding chemically denatured substrates

      • Mutations can disrupt substrate recognition

    4. C-terminal domain alterations:

      • Some DnaJ proteins (like dj2) have farnesylation motifs at their C-termini

      • Post-translational modification can be disrupted by mutations

      • For instance, farnesylation of dj2 is important for its function

    Studies in C. elegans have shown that mutations in DnaJ homologs can affect diverse physiological processes, from locomotion to resistance against protein aggregation in neurodegenerative disease models .

  • What role do DnaJ homologs like dnj-2 play in protection against proteotoxicity in neurodegenerative disease models?

    DnaJ homologs serve crucial protective functions against proteotoxicity in neurodegenerative disease models:

    1. Preventing protein aggregation:

      • Studies in C. elegans show that DnaJ proteins like DNJ-12 and DNJ-19 protect against aggregation of:

        • Amyloid-beta (Aβ) peptide in Alzheimer's disease models

        • α-synuclein in Parkinson's disease models

        • Polyglutamine proteins in Huntington's disease models

    2. Activation of protective responses:

      • DnaJ proteins trigger cytosolic unfolded protein responses through transcription factors like HSF-1

      • This response upregulates additional chaperones including HSP70 and HSP90

    3. Disaggregation activities:

      • DnaJ proteins work with Hsp70 and Hsp110 to disaggregate already formed protein aggregates

      • For example, DNJ-12 and DNJ-19 have been characterized for their protein disaggregase functions that promote organismal health

    4. Cross-compartmental protection:

      • Some ER-resident DnaJ proteins (like DNJ-27/ERdj5) can affect cytoplasmic protein homeostasis and mitochondrial integrity

      • DNJ-27 overexpression protects against mitochondrial fragmentation caused by Aβ and α-synuclein peptides

    When investigating dnj-2, researchers might explore its potential protective effects against protein aggregation in similar disease models, drawing on these established methodologies .

  • What are the challenges in expressing and purifying functional recombinant DnaJ proteins and how can they be overcome?

    Expressing and purifying functional DnaJ proteins presents several technical challenges:

    ChallengeSolutionEvidence
    Post-translational modificationsUse eukaryotic expression systemsFarnesylation of dj2 was enhanced in Sf9 cells by adding mevalonolactone to the medium
    Protein solubilityExpress as fusion proteins (MBP, GST)His-dj2 was successfully expressed as an MBP-His-dj2 fusion protein
    Preserving zinc coordinationInclude zinc in purification buffersThe cysteine-rich region coordinates zinc atoms essential for function
    Heterogeneity due to modificationsOptimize expression conditionsThe ratio of farnesylated to non-farnesylated forms varied between preparations
    Functional verificationDevelop reliable activity assaysATPase stimulation, luciferase refolding, and binding assays verify function

    For optimal results with recombinant dnj-2:

    1. Consider expressing in cell-free systems for rapid screening of conditions

    2. Verify the presence of all functional domains in the recombinant construct

    3. Include appropriate cofactors during purification

    4. Test functional activity using established assays before experimental use

    5. Store purified protein with stabilizing agents to prevent aggregation

    Protein quality control is essential, as the purity and homogeneity of recombinant DnaJ proteins directly impact experimental reproducibility .

  • How can computational approaches be used to predict dnj-2 interactions with client proteins?

    Computational approaches offer powerful methods to predict dnj-2 interactions with client proteins:

    1. Free energy-based binding matrices:

      • Develop position-specific scoring matrices based on amino acid preferences

      • Calculate ΔΔG binding values for each amino acid at every position in potential binding sites

      • Use equations like ΔΔG binding = -RT ln(Pb/Pn) to estimate binding energies

    2. Proteome-wide scanning algorithms:

      • Parse every possible binding sequence in the proteome

      • Evaluate each potential site for ΔΔG binding thresholds

      • Identify positive binding sites (e.g., <-2 kJ/mol for DnaJ)

    3. Structural prediction approaches:

      • Homology modeling based on known DnaJ structures

      • Molecular docking simulations with potential client proteins

      • Molecular dynamics to study binding stability

    4. Network analysis tools:

      • Protein interaction databases like BioGRID can identify potential partners

      • Analyze protein connectivity and interaction hubs

      • Essential genes (like dnj-2) often encode proteins that are in protein interaction hubs

    5. Evolutionary conservation analysis:

      • Compare binding preferences across species

      • Tools like InParanoid can identify orthologs in other species

      • Multiple sequence alignments reveal conserved binding regions

    These computational predictions should be validated experimentally using techniques like co-immunoprecipitation, yeast two-hybrid assays, or surface plasmon resonance to confirm actual interactions .

  • What methodologies are most effective for studying the role of dnj-2 in the unfolded protein response?

    The most effective methodologies for studying dnj-2's role in the unfolded protein response (UPR) include:

    1. UPR reporter systems:

      • Transgenic strains expressing fluorescent proteins under UPR-responsive promoters

      • For example, monitoring GFP expression driven by chaperone promoters like hsp-4 or hsp-6

      • These reporters can be crossed into dnj-2 mutant backgrounds

    2. RNA interference (RNAi) approaches:

      • Target dnj-2 in UPR reporter strains to assess effects on UPR activation

      • Combinatorial RNAi targeting multiple UPR components (e.g., ire-1, xbp-1, atf-6, pek-1) with dnj-2

      • Studies of DNJ-27 showed its expression is regulated by ire-1 and xbp-1 but not atf-6 or pek-1

    3. Stress challenge assays:

      • Expose dnj-2 mutants to ER stress inducers (tunicamycin, thapsigargin, DTT)

      • Measure survival, development, or behavior under stress conditions

      • Compare stress resistance to wild-type controls

    4. RT-qPCR analysis:

      • Quantify expression changes in UPR target genes in dnj-2 mutants

      • Assess dnj-2 expression changes during UPR activation

      • Monitor splicing of xbp-1 mRNA as a direct measure of IRE-1 activity

    5. Protein aggregation assays:

      • Use fluorescent reporters fused to aggregation-prone proteins

      • Assess how dnj-2 manipulation affects protein aggregation under ER stress

      • Similar methods revealed DNJ-27 protects against Aβ, α-synuclein, and polyQ aggregation

    6. Subcellular localization studies:

      • Fluorescently-tagged dnj-2 to determine localization under normal and stress conditions

      • Co-localization with organelle markers (ER, mitochondria)

      • DNJ-27 localization was confirmed using YFP::KDEL fusion proteins co-localized with the ER marker mCherry::TRAM-1

    These approaches would provide comprehensive insights into dnj-2's potential role in the unfolded protein response pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.