Recombinant Dog 3-hydroxyacyl-CoA dehydratase 1 (PTPLA)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Mechanism

PTPLA functions as a component of the fatty acid elongase (ELO) complex, which extends acyl-CoA chains in the endoplasmic reticulum. Its role includes:

  • Catalyzing Dehydration: Converts 3-hydroxyacyl-CoA to 2,3-trans-enoyl-CoA, enabling VLCFA synthesis .

  • Isoform-Specific Activity: The full-length (HACD1-FL) isoform exhibits enzymatic activity, while truncated variants (e.g., HACD1-D5, HACD1-167) lack this function .

Biochemical Activity

IsoformActivity StatusLocalizationInteraction with Elongase Complex
HACD1-FLActiveER membraneInteracts with all ELO components
HACD1-D5InactiveER membraneFails to bind TER (2,3-trans-enoyl-CoA reductase)
HACD1-167InactiveER membraneNo catalytic function

Research Applications and Findings

PTPLA has been studied extensively in models of congenital myopathies and lipid metabolism:

  • Muscle Pathology: Deficiency in HACD1/PTPLA causes centronuclear myopathy (CNM) in dogs, characterized by fiber size disproportion and progressive muscle weakness .

  • Membrane Fluidity: HACD1-FL regulates membrane composition by increasing monounsaturated fatty acids (MUFAs) and reducing saturated fatty acids (SFAs), thereby modulating membrane rigidity .

  • Lipid Metabolism: Knockdown of HACD1 disrupts VLCFA elongation, leading to reduced C18–C26 fatty acids and elevated lysophosphatidylcholine (LPC) levels, impairing myoblast fusion .

Key Experimental Insights

  • In Vitro Assays: HACD1-FL catalyzes the dehydration of 3-hydroxypalmitoyl-CoA to 2,3-trans-hexadecenoyl-CoA in a dose-dependent manner .

  • Rescue Experiments: Expression of HACD1-FL rescues growth defects in PHS1-deficient yeast, confirming its conserved function across species .

Clinical and Diagnostic Relevance

  • Canine Models: Labrador retrievers with HACD1 loss-of-function mutations exhibit early-onset myopathy, validating the enzyme’s role in muscle development .

  • Therapeutic Potential: Modulating HACD1 activity could address lipid-related disorders or improve membrane stability in muscular dystrophies .

Related Proteins and Nomenclature

NameSynonymsOrganism
HACD1PTPLA, CAPHuman, Dog
HACD2–HACD4PTPLB, PTPLAD1–2Human, Yeast
Phs1Yeast homologSaccharomyces cerevisiae

Note: HACD1 is distinct from true protein tyrosine phosphatases (PTPs) due to a conserved proline residue replacing the catalytic arginine in the PTP motif .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please note your request when placing the order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer components, storage temperature and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
HACD1; PTPLA; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 1; 3-hydroxyacyl-CoA dehydratase 1; HACD1; Protein-tyrosine phosphatase-like member A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
HACD1
Target Protein Sequence
MASSEEDGTNGGASEAGEEKEAPGRRRRLGLLATVWLTFYNIAMTAGWLVLAIAMVRFYM EKGTHKGLYKSIQKTLKFFQTFALLEIVHCLIGIVPTSVIVAGVQVSSRIFMVWLITHSI KPIQNEESVVLFLVAWTVTEITRYSFYTFSLLDHLPYFIKWARYNFFIILYPVGVVGELL TIYAALPYVKKTGMFSIRLPNKYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLH GEVIVEKDD
Uniprot No.

Target Background

Function
3-hydroxyacyl-CoA dehydratase 1 (PTPLA) catalyzes the third step in the four-step long-chain fatty acid elongation cycle. This endoplasmic reticulum-bound enzymatic process facilitates the addition of two carbons to the chain of long- and very long-chain fatty acids (VLCFAs) per cycle. PTPLA catalyzes the dehydration of the 3-hydroxyacyl-CoA intermediate to trans-2,3-enoyl-CoA within each cycle of fatty acid elongation. Therefore, it plays a crucial role in the production of VLCFAs of varying chain lengths, which are involved in numerous biological processes as precursors of membrane lipids and lipid mediators.
Gene References Into Functions
  1. Longitudinal analyses in myopathic Labrador retrievers revealed several membrane-associated defects, including ultrastructural triads dysmorphogenesis and mitochondrial mislocalization. PMID: 27939133
  2. Loss of function in myoblasts, knockout mice and spontaneously affected Labrador retrievers leads to reduced myoblast fusion (hypotrophy), associated with altered lipid composition and physical properties of membranes. PMID: 26160855
  3. Labrador retrievers carrying two copies of a unique HACD1 loss-of-function allele that recently disseminated worldwide, are all affected by a congenital myopathy, confirming its role in muscle development. PMID: 23071563
  4. A loss-of-function mutation identified by genetic mapping in a French pedigree of Labrador retrievers causes a congenital myopathy named centronuclear myopathy (CNM). PMID: 15829503
  5. confirm that dogs deficient in HACD1 are relevant models PMID: 27939133
  6. Haplotype analysis demonstrated that the PTPLA(cnm) allele resulted from a single and recent mutational event that may have rapidly disseminated through the extensive use of popular sires PMID: 23071563
  7. Described herein is a disease-associated insertion within PTPLA exon 2, found in both alleles of all affected Labradors and in a single allele in obligate carriers PMID: 15829503

Show More

Hide All

Database Links
Involvement In Disease
Defects in HACD1 may be the cause of autosomal recessive centronuclear myopathy in Labradors.
Protein Families
Very long-chain fatty acids dehydratase HACD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Tissue Specificity
Skeletal muscle.

Q&A

What is the relationship between HACD1 and PTPLA?

3-hydroxyacyl-CoA dehydratase 1 (HACD1) and protein tyrosine phosphatase-like A (PTPLA) are the same gene product. Initially annotated as PTPLA based on sequence homology, functional studies revealed its actual enzymatic role in fatty acid elongation as a dehydratase. The gene is commonly referenced as HACD1 in recent literature focusing on biochemical function, while PTPLA nomenclature persists in genetic studies, particularly those involving canine myopathies. Researchers should be aware of both designations when conducting literature searches to ensure comprehensive review of available data .

What is the functional role of HACD1/PTPLA in cellular metabolism?

HACD1 catalyzes the dehydration of 3-hydroxyacyl-CoA to 2,3-trans-enoyl-CoA during very long chain fatty acid (VLCFA) elongation. Enzymatic assays demonstrate that the full-length HACD1 protein catalyzes the dehydration of 3-hydroxypalmitoyl-CoA into 2,3-trans-hexadecenoyl-CoA in a dose-dependent manner. This activity is not exhibited by truncated isoforms (HACD1-D5, HACD1-167) or mutants with alterations to essential residues like Y171A . This catalytic step is critical for maintaining proper membrane composition and fluidity, with particular importance in muscle tissue development and function .

What mutations in canine HACD1/PTPLA are associated with myopathies?

The primary pathogenic mutation identified in Labrador retrievers with centronuclear myopathy (CNM) is a SINE (short interspersed nuclear element) insertion within exon 2 of the PTPLA gene. This mutation creates complex splicing defects in skeletal muscles, resulting in approximately 99% reduction in wild-type PTPLA transcripts, effectively creating a loss-of-function scenario . Molecular characterization through amplification and sequencing of the affected region shows remarkable conservation of this mutation across affected dogs worldwide, with no length polymorphisms or sequence variations detected in the inserted SINE .

What methods are most effective for genotyping the HACD1/PTPLA mutation in canine populations?

PCR-based genotyping targeting the SINE insertion site has proven highly effective for large-scale population screening. This approach was successfully employed to genotype 7,426 Labradors from 18 countries, identifying carriers in 13 countries. DNA extraction from blood samples or cheek swabs followed by PCR amplification with primers flanking the insertion site will yield different fragment sizes for wild-type and mutant alleles. Gel electrophoresis can then clearly distinguish between homozygous wild-type, heterozygous carrier, and homozygous affected genotypes. For confirmation, sequencing of PCR products can verify the exact nature of the mutation .

How can researchers assess HACD1 enzymatic activity in experimental settings?

Two complementary approaches are recommended for evaluating HACD1 enzymatic function:

  • In vitro enzymatic assays: Using purified recombinant HACD1 protein, researchers can measure the dehydration of 3-hydroxypalmitoyl-CoA to 2,3-trans-hexadecenoyl-CoA. This activity can be quantified using HPLC or LC-MS/MS to track substrate depletion and product formation. Control experiments should include known inactive variants (such as HACD1-Y171A) and dose-dependency studies to establish enzyme kinetics .

  • Yeast complementation studies: Expression of functional HACD1 in PHS1-shutdown yeast strains (PHS1 being the yeast ortholog) can rescue growth defects, providing a functional readout in a cellular context. This approach has confirmed that full-length HACD1, but not truncated isoforms or inactive mutants, complements PHS1 deficiency .

Both methods provide valuable insights, with the in vitro approach offering quantitative biochemical data and the yeast system providing assessment of function in a cellular environment.

What are the substrate specificities of different HACD family members?

Comparative analysis of HACD family members reveals overlapping but distinct substrate preferences:

This functional redundancy explains why HACD1 knockout models retain substantial 3-hydroxyacyl-CoA dehydratase activity, as HACD2 can partially compensate for HACD1 deficiency. Researchers investigating substrate specificity should employ fatty acid elongation assays using various acyl-CoA/fatty acid substrates rather than direct measurement with 3-OH acyl-CoA substrates .

What critical residues and domains are essential for HACD1 function?

Structure-function studies have identified key elements required for HACD1 enzymatic activity:

  • Tyrosine 171 (Y171): Point mutation of this residue to alanine (Y171A) completely abolishes enzymatic activity and the ability to rescue PHS1-deficient yeast, indicating its critical role in catalysis .

  • Full-length protein structure: Truncated isoforms (HACD1-D5, HACD1-167) lack dehydratase activity, highlighting the importance of complete protein architecture .

  • Fifth transmembrane segment: Contains the catalytically essential residues, including Y171 and a conserved glutamate. This region is encoded by exon 6 in mice, and targeted disruption of this exon creates functional knockout models .

For researchers conducting mutagenesis studies, these regions should be prioritized when investigating structure-function relationships or designing dominant-negative constructs.

How do canine and murine HACD1 deficiency models compare?

Both species demonstrate similar yet distinct phenotypic manifestations of HACD1 deficiency:

This phenotypic difference may reflect species-specific compensation mechanisms or differential tissue expression patterns of other HACD family members. Notably, no compensatory increases in HACD2, HACD3, or HACD4 mRNA levels were observed in Hacd1 knockout skeletal muscle, suggesting that baseline expression of these enzymes is sufficient for partial functional compensation .

What explains the variable phenotypic expression in dogs with identical HACD1/PTPLA mutations?

Affected Labradors homozygous for the PTPLA mutation exhibit a spectrum of clinical severity that cannot be explained by variations in the mutant allele itself. Detailed analysis revealed:

  • SINE sequence conservation: Visual comparison and sequencing of the PTPLA CNM allele from affected dogs showed no fragment length polymorphisms or base pair variations within the inserted SINE sequence .

  • Potential mechanisms: The variable expressivity likely depends on unidentified modifiers such as:

    • Functional polymorphisms elsewhere in the PTPLA gene

    • Variations in functionally redundant paralogs (particularly HACD2)

    • Additional genetic modifiers that influence the fatty acid elongation pathway

    • Environmental or epigenetic factors affecting gene expression

Researchers investigating this variability should consider whole-genome sequencing approaches, expression profiling of all HACD family members in affected tissues, and case-control studies examining potential environmental influences on phenotype severity.

What cellular processes are disrupted by HACD1 deficiency leading to myopathy?

The pathophysiological mechanisms linking HACD1 deficiency to muscle disease involve several interconnected pathways:

  • Membrane composition alterations: Impaired very long chain fatty acid elongation affects cellular membrane composition and fluidity, which is particularly critical in developing muscle fibers .

  • Muscle fiber formation: Studies indicate that HACD1 regulates membrane composition and fluidity in ways that promote proper muscle fiber formation. Deficiency leads to structural abnormalities that manifest as congenital myopathy .

  • Nuclear positioning: The progressive nuclear centralization observed in affected dogs represents a hallmark of centronuclear myopathies, suggesting disruption of mechanisms controlling nuclear localization within muscle fibers .

These processes reflect the importance of proper membrane composition in multiple aspects of muscle development and function. Research approaches should include lipidomic analysis of membrane composition, electron microscopy to assess ultrastructural changes, and investigation of nuclear positioning machinery in affected muscle fibers.

What therapeutic strategies show promise for HACD1/PTPLA-associated myopathies?

Several potential intervention approaches warrant investigation:

  • Gene replacement therapy: Viral vector-mediated delivery of functional HACD1/PTPLA specifically to muscle tissue could address the fundamental genetic deficiency. Adeno-associated virus (AAV) vectors with muscle-specific promoters would be most appropriate for this approach.

  • HACD2 upregulation: Given the functional redundancy between HACD1 and HACD2, pharmacological or genetic approaches to enhance HACD2 expression might compensate for HACD1 deficiency. High-throughput screening for compounds that selectively upregulate HACD2 in muscle tissue could identify candidate therapeutics.

  • Dietary supplementation: Strategic supplementation with specific very long chain fatty acids might bypass the elongation defect. Controlled feeding studies in canine models would help establish efficacy and optimal formulations.

  • Read-through therapies: For mutations creating premature stop codons in HACD1 (though not the primary canine SINE insertion), compounds promoting translational read-through could enable production of full-length protein.

The canine model provides an excellent large animal system for testing these approaches, offering advantages in terms of size, lifespan, and physiological relevance to human disease .

How can the canine HACD1/PTPLA model contribute to broader understanding of centronuclear myopathies?

Centronuclear myopathies in humans result from mutations in approximately 70 different genes, including members of the myotubularin, dynamin, and amphiphysin families. The HACD1-deficient Labrador model offers unique research opportunities:

  • Integrative pathway analysis: Comparing molecular pathways disrupted in different genetic forms of CNM could reveal convergent mechanisms and potential therapeutic targets. Research approaches should include comparative transcriptomics and proteomics between HACD1-deficient tissues and other CNM models.

  • Large animal drug testing platform: The Labrador model permits evaluation of therapies in a system more closely resembling human physiology than rodent models, particularly for assessing drug delivery, pharmacokinetics, and long-term efficacy .

  • Novel gene discovery: Approximately 30% of human CNM cases remain genetically unresolved. Comparative studies between canine and human CNM could identify novel candidate genes in the remaining unexplained cases.

The relatively high prevalence of the mutation in pet Labradors worldwide provides a unique opportunity for natural history studies and clinical trial recruitment that is unavailable for most other large animal models of genetic disease .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.