Recombinant Dog 5-hydroxytryptamine receptor 1B (HTR1B)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant HTR1B is synthesized using heterologous expression systems for structural and functional studies.

Expression Systems:

  • Hosts: E. coli, yeast, baculovirus, mammalian cells

  • Purity: ≥85% (verified via SDS-PAGE)

  • Storage: Lyophilized or in solution at -20°C/-80°C with glycerol stabilizers

Example Production Workflow (Cusabio):

  1. Cloning: Partial HTR1B gene inserted into expression vectors .

  2. Expression: Optimized in E. coli for soluble protein yield .

  3. Purification: Affinity chromatography followed by buffer exchange .

Functional Roles in Canine Physiology

  • Neurotransmitter Regulation: Modulates serotonin, dopamine, and acetylcholine release in the brain .

  • Behavioral Impact: Linked to mood disorders, aggression, and anxiety in dogs .

  • Vascular Function: Mediates vasoconstriction in cerebral arteries .

Key Research Findings:

  • Pharmacological profiling shows dog HTR1B binds [<sup>3</sup>H]5-HT with high affinity (pK<sub>d</sub> = 8.1), comparable to human receptors .

  • Inverse agonism by methiothepin and partial agonism by GR127935 highlight conserved signaling mechanisms across species .

Research Applications

Disease Modeling

  • Used to study serotonin dysregulation in psychiatric disorders .

  • Polymorphisms in canine HTR1B correlate with behavioral phenotypes .

Drug Development

  • Agonists: Frovatriptan (selective for 1B/1D subtypes) .

  • Antagonists: SB-224289 (used to study migraine pathways) .

Comparative Pharmacology

  • Dog HTR1B shares 75% sequence homology with human receptors but differs in ligand-binding kinetics from rat orthologs .

Pharmacological Profile

Ligand TypeCompoundActivity (Dog HTR1B)Cross-Reactivity
EndogenousSerotonin (5-HT)Full agonist (EC<sub>50</sub> = 10 nM) Human, rat
SyntheticGR127935Partial agonist Human-specific
InhibitorMethiothepinInverse agonist Pan-species

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HTR1B; 5-hydroxytryptamine receptor 1B; 5-HT-1B; 5-HT1B; 5-HTR1B; 5-HT1D subtype beta; Serotonin receptor 1B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-389
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MEAAGAPCAPPPPAGSQTGAPPANLSSAPHNCSAEGYIYQDSVALPWKVLLVILLALITL ATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVV CDLWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISIS LPPFFWRQAKAEEEVSDCVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILK QTPNRTGKRLTRAQLITDSPGSTSSVTSVNSRAPDVPSESGSPVYVNQVKVRVSDALLEK KKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYLN SLINPIIYTMSNEDFKQAFHKLIRFKCAG
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 1B (HTR1B) is a G-protein coupled receptor that binds 5-hydroxytryptamine (serotonin). It also acts as a receptor for various alkaloids and psychoactive substances. Ligand binding induces a conformational change, initiating signaling through guanine nucleotide-binding proteins (G proteins) and modulating downstream effectors such as adenylate cyclase. This signaling inhibits adenylate cyclase activity. Arrestin family members inhibit G protein signaling and mediate alternative signaling pathways. HTR1B regulates the release of 5-hydroxytryptamine, dopamine, and acetylcholine in the brain, impacting neural activity, nociception, pain perception, mood, and behavior. Additionally, it plays a role in cerebral artery vasoconstriction.
Gene References Into Functions
  1. Gene does not play a major role in the variation in aggression in Golden Retrievers. PMID: 18066658
Database Links

KEGG: cfa:403741

UniGene: Cfa.3604

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural and pharmacological characterization of recombinant dog 5-HT1B receptors?

The dog 5-HT1B receptor is a G-protein coupled receptor with seven transmembrane domains, structurally similar to other mammalian 5-HT1B receptors. When stably expressed in Chinese hamster ovary cells (CHO-K1), it exhibits high-affinity binding to [3H]5-HT with a pKd of 8.1, indicating a homogeneous population of binding sites . Pharmacological characterization using [3H]5-HT binding and agonist-induced [35S]GTPγS binding studies reveals that the dog 5-HT1B receptor displays properties more comparable to human than rat 5-HT1B receptors . This similarity makes the dog receptor particularly valuable for translational research and drug development activities.

The receptor demonstrates negative coupling to adenylyl cyclase via Gi/o proteins, resulting in decreased intracellular cAMP levels upon activation. In recombinant systems, both methiothepin and GR127935 exhibit distinctive pharmacological profiles across species: methiothepin displays inverse agonism, while GR127935 demonstrates weak partial agonism in dog, human, and rat 5-HT1B receptor-expressing cell lines . These properties can be leveraged to study receptor-mediated signaling mechanisms in various experimental setups.

How does the dog 5-HT1B receptor compare to 5-HT1B receptors from other species?

Comparative pharmacological studies reveal that the dog 5-HT1B receptor shares greater similarity with the human receptor than with rodent receptors . This distinction is particularly evident in binding and functional studies, where similar pharmacological profiles are observed between dog and human receptors. The comparative pharmacology can be examined through multiple experimental approaches, including radioligand binding, G-protein activation, and second messenger studies.

Species differences between rodent and non-rodent 5-HT1B receptors are thought to arise largely from a single amino acid substitution in the transmembrane region (Thr335 in humans is replaced by Asn in rodents) . This molecular difference affects the binding properties of certain ligands, such as cyanopindolol, which show differential affinities across species . Understanding these molecular determinants is crucial for developing species-selective compounds and for proper interpretation of cross-species data in drug discovery programs.

What experimental systems are most suitable for expressing recombinant dog 5-HT1B receptors?

Chinese hamster ovary (CHO-K1) cells (ATCC CCL 61) have been successfully employed for stable expression of cloned dog 5-HT1B receptors . This expression system provides reliable receptor expression with appropriate pharmacological and functional characteristics. Alternative mammalian expression systems that have been used for 5-HT1B receptors from other species include rat C6-glial cells, which have been employed for rabbit 5-HT1B receptor expression .

For optimal expression and experimental outcomes, several methodological factors should be considered:

  • Selection of expression vectors with strong constitutive promoters (e.g., CMV) for consistent receptor expression

  • Optimization of transfection methodology for the specific cell line

  • Selection of stable transfectants using appropriate markers

  • Verification of receptor expression through radioligand binding assays

  • Assessment of receptor functionality through signal transduction assays

  • Consideration of the cellular environment, including endogenous G-protein expression

The choice of expression system may influence receptor pharmacology and signaling properties, highlighting the importance of system validation for specific research questions.

What are the optimal binding assay conditions for characterizing dog 5-HT1B receptors?

Optimized binding assay conditions are essential for reliable characterization of dog 5-HT1B receptors. Based on published protocols, the following methodological approaches are recommended:

Membrane preparation:

  • Harvest cells expressing recombinant dog 5-HT1B receptors

  • Homogenize in ice-cold buffer (typically Tris-HCl, pH 7.4)

  • Centrifuge at high speed (>20,000g) to collect membrane fraction

  • Resuspend membranes in binding buffer

  • Determine protein concentration using standard methods (e.g., Bradford assay)

Saturation binding assays:

  • Incubate membranes (~10-50 μg protein) with increasing concentrations of [3H]5-HT (0.1-30 nM)

  • Perform assays in Tris-HCl buffer (50 mM, pH 7.4) containing MgCl2 (4 mM) and ascorbic acid (0.1%) to prevent oxidation

  • Incubate at room temperature for 30-60 minutes to reach equilibrium

  • Define non-specific binding using excess unlabeled 5-HT (10 μM)

  • Terminate binding by rapid filtration through glass fiber filters

  • Quantify bound radioligand by liquid scintillation counting

Competition binding assays:

  • Use a fixed concentration of [3H]5-HT (typically near Kd value, ~1-2 nM)

  • Include increasing concentrations of test compounds (10^-10 to 10^-4 M)

  • Calculate IC50 values and convert to Ki using the Cheng-Prusoff equation

These methodological details ensure reproducible pharmacological characterization of the dog 5-HT1B receptor and facilitate cross-laboratory comparisons.

How can functional coupling of recombinant dog 5-HT1B receptors be assessed?

Multiple methodological approaches can be employed to assess the functional coupling of recombinant dog 5-HT1B receptors:

  • [35S]GTPγS binding assays:

    • This method directly measures G-protein activation upon receptor stimulation

    • Membranes are incubated with [35S]GTPγS in the presence of GDP and various agonists

    • Increased binding of [35S]GTPγS indicates receptor-mediated G-protein activation

    • This approach has been successfully used to characterize agonist and inverse agonist properties at the dog 5-HT1B receptor

  • cAMP assays:

    • Since 5-HT1B receptors inhibit adenylyl cyclase, measuring cAMP reduction provides a functional readout

    • Cells are typically stimulated with forskolin to elevate cAMP levels

    • Agonist-induced inhibition of forskolin-stimulated cAMP production is measured

    • Multiple detection methods are available, including radioimmunoassay, ELISA, and HTRF-based approaches

  • Reporter gene assays:

    • Cells can be transfected with CRE-responsive reporter constructs (e.g., luciferase)

    • Changes in reporter gene expression reflect alterations in cAMP-dependent transcription

    • This provides an amplified signal for detecting small changes in second messenger levels

  • Electrophysiological methods:

    • When co-expressed with appropriate ion channels (e.g., GIRK), 5-HT1B receptor activation can be measured as changes in membrane currents

    • This approach provides high temporal resolution of receptor signaling

These methodologies allow comprehensive characterization of receptor-mediated signaling and can reveal subtle differences in signaling properties between species variants or in response to different ligands.

What are the implications of species differences in 5-HT1B receptor pharmacology for translational research?

Species differences in 5-HT1B receptor pharmacology have significant implications for translational research and drug development :

  • Predictive validity of animal models:
    The greater similarity between dog and human 5-HT1B receptors compared to rodent receptors suggests that canine models may provide better predictive validity for human responses to 5-HT1B-targeted drugs . This is particularly relevant for therapeutic areas like migraine, where 5-HT1B receptors are important drug targets.

  • Molecular basis for pharmacological differences:
    A single amino acid substitution in the transmembrane region (Thr335 in humans vs. Asn in rodents) accounts for many pharmacological differences between species . Understanding these molecular determinants helps in designing compounds with desired species selectivity profiles.

  • Compound selection for in vivo studies:
    The pharmacological profile of test compounds should be characterized across species receptors before selecting animal models for in vivo efficacy studies. Compounds showing similar profiles at dog and human receptors may be better candidates for translational studies.

  • Physiological response differences:
    Beyond binding and signaling differences, the physiological responses mediated by 5-HT1B receptors may vary between species. For example, 5-HT1B activation leads to hyperlocomotion in mice and hypothermia in guinea pigs but not rats , highlighting the complexity of extrapolating from animal models to humans.

  • Target validation strategies:
    Given species differences, comprehensive target validation should incorporate multiple approaches, including recombinant receptor studies across species, tissue-based assays, and in vivo models with careful consideration of species-specific responses.

These considerations underscore the importance of thorough cross-species characterization in the development of 5-HT1B receptor-targeted therapeutics.

How can PET-MR imaging be used to study 5-HT1B receptor function in vivo?

Combined positron emission tomography and magnetic resonance imaging (PET-MR) represents a powerful methodology for studying 5-HT1B receptor function in vivo . This approach offers unique advantages for investigating receptor occupancy, functional responses, and pharmacokinetic-pharmacodynamic relationships:

  • Simultaneous measurement of receptor occupancy and hemodynamic responses:

    • PET with selective 5-HT1B receptor radioligands (e.g., [11C]-labeled ligands) quantifies receptor occupancy

    • Concurrent MR measures cerebral blood volume (CBV) changes, reflecting functional consequences of receptor modulation

    • This simultaneous measurement directly links receptor engagement with physiological responses

  • Pharmacokinetic-pharmacodynamic (PK-PD) analysis:

    • The temporal profile of drug concentrations in blood can be correlated with receptor occupancy and hemodynamic responses

    • This allows determination of PK-PD relationships critical for drug development

    • The approach can reveal the time course of drug action and potential hysteresis effects

  • Spatial mapping of receptor distribution and function:

    • High spatial resolution permits region-specific analysis of receptor density and drug effects

    • Differences in receptor function between brain regions can be identified

    • This spatial information is particularly valuable for understanding the neural circuits involved in 5-HT1B-mediated effects

  • Quantitative modeling of hemodynamic responses:
    Hemodynamic responses measured by MR can be quantitatively modeled using gamma variate functions:

    CBV(t)=A(tt0)αe(tt0)/βCBV(t) = A \cdot (t - t_0)^\alpha \cdot e^{-(t - t_0)/\beta}

    Where parameters A, α, and β characterize the amplitude, rise time, and decay of the response, respectively .

  • Differentiation of agonist vs. antagonist effects:

    • Agonists and antagonists produce distinct hemodynamic signatures

    • These differential responses can be used to classify novel compounds and understand their mechanism of action

This methodology provides a comprehensive in vivo assessment of drug effects on 5-HT1B receptors, bridging the gap between in vitro characterization and behavioral pharmacology.

What methods can distinguish between 5-HT1B and closely related receptor subtypes?

Distinguishing between 5-HT1B and closely related receptor subtypes, particularly 5-HT1D, presents significant methodological challenges due to their similar pharmacological profiles . Several complementary approaches can be employed:

  • Selective pharmacological tools:
    Only a limited number of compounds can effectively discriminate between 5-HT1B and 5-HT1D receptors. The following table summarizes available selective tools:

    CompoundSelectivityKi or EC50 ratio (5-HT1D/5-HT1B)
    CP-93,1295-HT1B selective agonist>100
    L-694,2475-HT1D selective agonist~30
    BRL-155725-HT1D selective antagonist~60
    SB-2242895-HT1B selective antagonist~80

    When using these tools, complete concentration-response curves should be generated to confirm subtype selectivity in the experimental system .

  • Molecular biology approaches:

    • Subtype-specific RT-PCR to identify receptor expression patterns

    • In situ hybridization to localize receptor mRNA in tissues

    • Specific antibodies for immunohistochemistry or Western blotting (with careful validation)

    • Site-directed mutagenesis to introduce species-specific amino acid changes that alter pharmacological profiles

  • Recombinant expression systems:

    • Heterologous expression of individual receptor subtypes allows direct comparison

    • Co-expression studies to investigate potential interactions between subtypes

    • CRISPR/Cas9-mediated knockout of specific subtypes in cell lines

  • Species differences as tools:

    • Leveraging known species differences in 5-HT1B receptor pharmacology

    • Comparing responses in tissues from different species with known receptor expression profiles

    • Using chimeric receptors containing domains from different species to identify critical determinants of selectivity

  • Functional discrimination:

    • Exploring potential differences in signaling pathways or desensitization kinetics

    • Investigating tissue-specific or cell type-specific responses that may reflect differential expression or coupling

These methodological approaches, often used in combination, provide complementary evidence for receptor subtype involvement in specific physiological or pharmacological responses.

What approaches can address heterogeneous 5-HT receptor expression in native tissues?

Native tissues frequently express multiple 5-HT receptor subtypes, resulting in complex, sometimes opposing responses to serotonergic stimulation . Several methodological approaches can help dissect these heterogeneous responses:

  • Pharmacological dissection using selective ligands:

    • Sequential application of subtype-selective antagonists to isolate receptor components

    • As demonstrated in dog antral longitudinal muscle, a combination of methysergide (5-HT1/2/5/6/7 antagonist), granisetron (5-HT3 antagonist), and GR 113808 (5-HT4 antagonist) was required to fully block 5-HT-induced responses

    • Construction of cumulative concentration-response curves in the presence of various antagonist combinations

  • Statistical analysis of response variability:

    • Quantitative analysis of response heterogeneity as an indicator of multiple receptor involvement

    • Increased variability in responses following blockade of specific receptor subtypes may reveal opposing actions of remaining receptors

  • Temporal dissection of responses:

    • Analysis of biphasic or multiphasic responses based on different kinetic profiles

    • Time-course studies to separate rapid versus delayed components

    • Analysis of desensitization patterns characteristic of specific receptor subtypes

  • Tissue-specific expression analysis:

    • RT-PCR, in situ hybridization, or immunohistochemistry to map receptor subtype expression

    • Single-cell RNA sequencing to characterize receptor expression profiles in individual cells

    • Correlation of expression patterns with functional responses

  • Genetic approaches:

    • Use of tissues from receptor subtype knockout animals

    • siRNA knockdown of specific receptor subtypes in tissue preparations

    • CRISPR/Cas9-mediated genetic modification of specific cell types

  • Mathematical modeling:

    • Development of quantitative models incorporating multiple receptor subtypes

    • Fitting experimental data to complex models to estimate the contribution of each receptor subtype

    • Simulation studies to predict responses to novel compounds or combinations

How do functional responses to 5-HT1B receptor activation differ across species and tissues?

Functional responses to 5-HT1B receptor activation exhibit notable species and tissue differences, which have important implications for drug development and translational research :

  • Species-specific behavioral responses:

    • In mice, 5-HT1B receptor activation produces hyperlocomotion

    • In guinea pigs, it leads to hypothermia

    • In rats, such responses are less pronounced, while hypophagia and penile erection are observed

    • These differences likely reflect variations in receptor distribution, density, or coupling efficiency across species

  • Cognitive effects:

    • In rats, 5-HT1B receptor antagonists like NAS-181 facilitate passive avoidance learning and can block the impairment caused by agonists like anpirtoline

    • These effects are thought to involve enhanced cholinergic transmission

    • The magnitude of these effects may vary between species based on the degree of serotonergic regulation of cholinergic systems

  • Vascular responses:

    • 5-HT1B receptors mediate vasoconstriction in cerebral arteries

    • The potency and efficacy of 5-HT1B agonists in vascular tissues vary across species

    • These differences may reflect varying receptor densities or coupling efficiencies in vascular smooth muscle

    • The dog may provide a better translational model than rodents for studying vascular effects relevant to migraine

  • Neurochemical effects:

    • As autoreceptors, 5-HT1B receptors inhibit serotonin release

    • As heteroreceptors, they inhibit release of various neurotransmitters including acetylcholine, glutamate, GABA, and noradrenaline

    • The relative importance of these roles may differ between species and brain regions

Understanding these species and tissue differences is essential for proper experimental design and interpretation of results in 5-HT1B receptor research. Comparative studies utilizing recombinant receptors from multiple species help elucidate the molecular basis for these functional differences.

What is the molecular basis for pharmacological differences between dog and rodent 5-HT1B receptors?

The molecular basis for pharmacological differences between dog and rodent 5-HT1B receptors has been investigated through comparative pharmacological studies and molecular analysis :

  • Key amino acid differences:

    • A single amino acid substitution in the transmembrane region (Thr335 in human/dog vs. Asn in rodents) accounts for many pharmacological differences

    • This substitution affects the binding pocket configuration, particularly influencing interaction with certain ligands

    • The Thr335 position is located in transmembrane domain 7, a region critical for ligand binding

  • Binding site differences:

    • The amino acid substitution alters the electronic and steric properties of the binding pocket

    • This affects the interaction with ligands containing specific chemical moieties

    • For example, compounds with N-4 substituted 1-piperazinyl components show differential binding across species

  • Functional coupling differences:

    • G-protein coupling efficiency may differ between species variants

    • The efficiency of signal transduction from receptor activation to second messenger modulation may vary

    • These differences might explain varying potencies of agonists across species despite similar binding affinities

  • Experimental evidence:

    • Radioligand binding studies show that dog 5-HT1B receptors exhibit pharmacological profiles more similar to human than rodent receptors

    • [3H]5-HT inhibition and agonist-induced [35S]GTPγS binding studies confirm these similarities

    • Site-directed mutagenesis studies in related 5-HT receptors support the critical role of transmembrane domain 7 in species selectivity

Understanding these molecular determinants provides a rational basis for designing experiments and interpreting results across species, particularly when evaluating compounds for potential therapeutic development. The greater similarity between dog and human 5-HT1B receptors supports the use of canine models for certain aspects of 5-HT1B receptor pharmacology.

What strategies can optimize the use of recombinant dog 5-HT1B receptors in drug discovery?

Recombinant dog 5-HT1B receptors offer valuable tools for drug discovery, particularly for conditions where these receptors represent therapeutic targets. The following strategies can optimize their use in drug development programs:

  • Multi-species profiling approach:

    • Characterize compounds across dog, human, and rodent 5-HT1B receptors

    • Select compounds with consistent pharmacology across species for in vivo evaluation

    • Use dog receptor data to better predict human responses when designing preclinical studies

  • Comprehensive pharmacological characterization:

    • Assess both binding affinity and functional activity (full agonism, partial agonism, antagonism, inverse agonism)

    • Evaluate potential functional selectivity (biased signaling) across different pathways

    • Compare potency ratios between receptor subtypes to assess selectivity margins

  • Structure-activity relationship (SAR) development:

    • Use dog 5-HT1B receptor data to develop SAR models complementary to human receptor data

    • Identify molecular features that confer species selectivity or cross-species activity

    • Design compounds with optimal properties for translational studies

  • Informed selection of in vivo models:

    • Knowledge of dog 5-HT1B receptor pharmacology can guide selection of appropriate animal models

    • For CNS indications, consider using species with 5-HT1B pharmacology more similar to humans

    • For specific disorders like migraine, consider dog models given the similarity to human receptors

  • Application to specific therapeutic areas:

    • Migraine: Evaluate effects on vascular tone and neurogenic inflammation

    • Psychiatric disorders: Assess impact on neurotransmitter release and behaviors relevant to depression, anxiety, or aggression

    • Cognitive enhancement: Investigate potential of 5-HT1B antagonists to facilitate learning and memory through enhanced cholinergic transmission

  • Development of translational biomarkers:

    • Identify responses to 5-HT1B receptor modulation that translate across species

    • Develop imaging approaches (e.g., PET-MR) that can be applied in both preclinical models and clinical studies

    • Establish pharmacokinetic-pharmacodynamic relationships that predict efficacious doses in humans

These strategies leverage the translational value of dog 5-HT1B receptors to enhance drug discovery efforts aimed at modulating serotonergic neurotransmission for therapeutic benefit.

What technical challenges exist in establishing stable recombinant dog 5-HT1B receptor expression systems?

Establishing stable recombinant dog 5-HT1B receptor expression systems presents several technical challenges that researchers should address through careful methodological approaches:

  • Receptor expression level optimization:

    • Very high expression can lead to constitutive activity or receptor aggregation

    • Too low expression may yield insufficient signal-to-noise ratio in functional assays

    • Inducible expression systems (e.g., tetracycline-regulated) can provide controlled expression levels

    • Regular monitoring of receptor density through saturation binding is essential for maintaining consistent pharmacological profiles

  • G-protein coupling efficiency:

    • Expression systems may vary in their complement of G-proteins

    • Coupling efficiency can affect apparent potency of agonists in functional assays

    • Co-expression of specific G-protein subunits may enhance signaling efficiency

    • Characterization of coupling efficiency through [35S]GTPγS binding helps normalize functional data

  • Receptor trafficking and surface expression:

    • GPCRs may be retained intracellularly or undergo rapid internalization

    • Addition of signal sequences or epitope tags may facilitate surface expression

    • Use of receptor-GFP fusion proteins can enable monitoring of trafficking

    • Flow cytometry with surface-specific antibodies can quantify membrane expression

  • Cell line selection considerations:

    • Different cell backgrounds (CHO, HEK293, C6-glial) provide different signaling environments

    • Endogenous receptors may complicate interpretation of results

    • Growth characteristics and transfection efficiency vary between cell types

    • CHO-K1 cells have proven successful for dog 5-HT1B receptor expression

  • Constitutive activity management:

    • Recombinant 5-HT1B receptors often exhibit constitutive activity

    • This activity may complicate pharmacological characterization, particularly of partial agonists

    • Inverse agonists like methiothepin can be used to assess and manipulate constitutive activity

    • Experimental conditions (serum, cell density) may influence basal activity

  • Clonal variation:

    • Individual clones may exhibit different pharmacological properties

    • Pooled stable transfectants may provide more representative receptor populations

    • Multiple clones should be characterized to ensure consistent pharmacology

    • Periodic re-selection may be necessary to maintain stable expression over passages

Addressing these challenges through careful methodological approaches ensures reliable and reproducible pharmacological data for drug discovery and basic research applications.

How can computational approaches enhance the understanding of dog 5-HT1B receptor pharmacology?

Computational approaches offer powerful tools to enhance understanding of dog 5-HT1B receptor pharmacology and accelerate drug discovery efforts:

  • Homology modeling and molecular dynamics simulations:

    • Development of 3D structural models based on crystallized human 5-HT1B receptor

    • Identification of key binding pocket differences between dog and other species

    • Simulation of receptor dynamics in membrane environment

    • Prediction of conformational changes associated with activation or inverse agonism

  • Virtual screening and docking studies:

    • In silico screening of compound libraries against dog 5-HT1B receptor models

    • Comparison of binding modes across species variants

    • Prediction of species selectivity based on binding energy calculations

    • Structure-based design of novel ligands with desired pharmacological profiles

  • Quantitative structure-activity relationship (QSAR) models:

    • Development of predictive models for binding affinity and functional activity

    • Identification of molecular descriptors that correlate with species selectivity

    • Integration of data from multiple assay formats to build comprehensive models

    • Application to virtual compound libraries to prioritize synthesis candidates

  • Systems pharmacology modeling:

    • Integration of receptor-level data into physiological pathway models

    • Prediction of in vivo responses based on in vitro pharmacological parameters

    • Modeling of pharmacokinetic-pharmacodynamic relationships

    • Comparison of predicted responses across species to guide translational research

  • Machine learning approaches:

    • Pattern recognition in large pharmacological datasets to identify structure-activity trends

    • Deep learning models trained on diverse 5-HT1B ligand datasets

    • Prediction of off-target activities and potential side effects

    • Integration of genomic, proteomic, and pharmacological data to identify novel applications

These computational approaches complement experimental studies and can significantly accelerate the discovery and optimization of selective 5-HT1B receptor ligands with desired properties for research and therapeutic applications.

What emerging technologies could advance the functional characterization of dog 5-HT1B receptors?

Several emerging technologies hold promise for advancing the functional characterization of dog 5-HT1B receptors:

  • CRISPR/Cas9 genome editing:

    • Generation of cell lines with precise modifications to dog 5-HT1B receptors

    • Introduction of reporter tags for live-cell imaging without disrupting function

    • Creation of 5-HT1B knockout models for establishing signal specificity

    • Engineering of cells with humanized or rodentized receptors for comparative studies

  • Biosensor technologies:

    • Development of FRET/BRET-based sensors for real-time monitoring of receptor activation

    • Conformational biosensors that report directly on receptor state changes

    • G-protein dissociation sensors to measure activation kinetics

    • Multiplexed sensors to simultaneously monitor multiple signaling pathways

  • Label-free technologies:

    • Surface plasmon resonance for real-time binding kinetics

    • Dynamic mass redistribution assays for integrated cellular responses

    • Impedance-based cell analysis for morphological changes associated with signaling

    • These approaches avoid potential artifacts associated with modified ligands or receptors

  • Single-cell analysis:

    • Patch-clamp fluorometry to correlate structural dynamics with function

    • Single-cell RNA-seq to characterize receptor expression in native tissues

    • High-content imaging to assess receptor trafficking and signaling at subcellular resolution

    • Microfluidic platforms for precise manipulation of cellular environment

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize receptor organization in membrane microdomains

    • Multi-photon microscopy for deep tissue imaging in ex vivo preparations

    • Expansion microscopy for nanoscale visualization of receptor complexes

    • Light-sheet microscopy for rapid 3D imaging with reduced phototoxicity

  • Chemogenetic and optogenetic approaches:

    • Development of dog 5-HT1B receptor DREADD constructs for selective activation

    • Light-activated 5-HT1B receptors for spatiotemporal control of signaling

    • Combination with in vivo physiological measurements for causality testing

    • Integration with electrophysiological recordings for multi-modal characterization

These technologies offer unprecedented resolution in spatial, temporal, and molecular dimensions, enabling more comprehensive characterization of 5-HT1B receptor function in both recombinant systems and native tissues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.