Recombinant Dog 5-hydroxytryptamine receptor 2C (HTR2C)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

The HTR2C receptor belongs to the serotonin 5-HT2 family of G-protein-coupled receptors (GPCRs), which mediate serotonin-induced signaling through phospholipase C (PLC) activation. In dogs (Canis familiaris), HTR2C is expressed as a full-length protein (458 amino acids) with sequence homology to human and rodent orthologs. Recombinant production enables precise structural and functional studies, particularly for understanding serotonin’s role in canine physiology and drug development.

Signaling Pathways

HTR2C activates Gαq/11 proteins, leading to:

  1. Phospholipase C (PLC) activation: Generates inositol trisphosphate (IP3) and diacylglycerol (DAG), mobilizing intracellular calcium and activating protein kinase C .

  2. Modulation of neuronal activity: Regulates appetite, stress responses, and hormonal release (e.g., corticosterone) .

Ligand Interactions

Ligand TypeExample CompoundsInteraction ProfileSource
AgonistsErgolines (e.g., ergotamine)Bind to orthosteric site, inducing receptor activation and PLC signaling
AntagonistsRitanserin, MirtazapineBlock serotonin binding, inhibit PLC activity
PET Tracers[18F]4 (fluorophenethoxy-pyrimidine)High-affinity binding, used for imaging 5-HT2C distribution in vivo

Key Note: The dog HTR2C shares structural homology with human HTR2C, enabling cross-species pharmacological studies .

Key Uses

  1. Drug Discovery: Screening serotonin agonists/antagonists for veterinary or human applications (e.g., anxiety, obesity) .

  2. Structural Biology: Studying receptor conformational changes via X-ray crystallography (e.g., ligand binding pockets) .

  3. Neurophysiological Studies: Investigating serotonin’s role in appetite regulation, stress responses, and neuroendocrine pathways .

Example Experimental Workflow

StepDescriptionSource
ExpressionFull-length HTR2C cloned into mammalian expression vectors (e.g., pFastbac)
PurificationAffinity chromatography (His-tag) followed by size-exclusion chromatography
Functional AssaysIP3/DAG production assays, electrophysiological recordings (e.g., Xenopus oocytes)

Comparative Analysis with Other Species

FeatureDog (HTR2C)Human (HTR2C)Rat (HTR2C)
Uniprot IDQ60F97P28335P08909
ChromosomeNot specifiedXq23Xq34
RNA EditingNot documentedDocumented (ADAR-mediated)Documented
G-Protein CouplingGαq/11Gαq/11Gαq/11

Key Observations:

  • Conservation: High sequence similarity across mammals, particularly in transmembrane domains .

  • Divergence: Human HTR2C undergoes RNA editing, altering receptor isoforms and G-protein coupling efficiency .

Production and Quality Control

ParameterDescriptionSource
Expression SystemMammalian cells (e.g., HEK293) or insect cells (Sf9)
Purity>95% (SDS-PAGE, HPLC)
Storage-20°C in Tris-based buffer with 50% glycerol
StabilityAvoid repeated freeze-thaw cycles; aliquot for short-term use (4°C)

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
HTR2C; 5-hydroxytryptamine receptor 2C; 5-HT-2C; 5-HT2C; 5-HTR2C; Serotonin receptor 2C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-458
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MVNLRKAVHSFLVHLIGLLVWQCDISVSPVAALVTDIFNTSDGGRFKFPDGVQNWPALSI VIIIILTIGGNILVIMAVSLEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPVEHSRFNSRTKAIMKIAIVWA ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIHV LRRQALMLLHGHVEEPPRINLDFLKCCRRNGTEEENSANPNQDSNPRRRKKKERRPRGTM QAINNERKASKVLGIVFFVFLVMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVC SGINPLVYTLFNKIYRRAFSNYLRCNYKPEKKPPVRQMPRVAATALSGRELNVNIYRHTN EPVLKKANDKEPGIEMQVENLELPVNPSSVVSERISSV
Uniprot No.

Target Background

Function
The 5-hydroxytryptamine receptor 2C (HTR2C) is a G-protein coupled receptor for 5-hydroxytryptamine (serotonin) in dogs. It also functions as a receptor for various drugs and psychoactive substances, including ergot alkaloid derivatives, 1-2,5,-dimethoxy-4-iodophenyl-2-aminopropane (DOI), and lysergic acid diethylamide (LSD). Ligand binding triggers a conformational change that initiates signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of downstream effectors. Members of the beta-arrestin family inhibit signaling via G proteins and mediate the activation of alternative signaling pathways. Signaling activates a phosphatidylinositol-calcium second messenger system, modulating the activity of phosphatidylinositol 3-kinase and downstream signaling cascades, ultimately promoting the release of Ca(2+) ions from intracellular stores. HTR2C regulates neuronal activity by activating short transient receptor potential calcium channels in the brain. This, in turn, modulates the activation of pro-opiomelanocortin neurons and the release of corticotropin-releasing hormone (CRH), which then regulates the release of corticosterone. HTR2C plays a role in regulating appetite and feeding behavior, responses to anxiogenic stimuli and stress, and it influences insulin sensitivity and glucose homeostasis.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of dog HTR2C and how does it compare to human HTR2C?

Dog HTR2C (UniProt ID: Q60F97) is a G-protein coupled receptor belonging to the serotonin receptor family . Like other 5-HT2C receptors, it contains seven transmembrane domains and likely has a phosphorylation site in the cytoplasmic tail as observed in other species . The dog HTR2C gene is located on the X chromosome and encodes a protein that shares high homology with human HTR2C .

Comparative genomic studies have identified ten fixed SNP differences between dog and wolf HTR2C genes, suggesting evolutionary changes associated with domestication . These genetic variations may contribute to differences in receptor function and signaling efficiency between canids and other species.

What signaling pathways are associated with the dog HTR2C receptor?

Based on studies in other species, dog HTR2C likely couples primarily to Gq/11 proteins, activating phospholipase C and D signaling pathways . Activation of the receptor leads to increased intracellular calcium and subsequent neuronal excitation. Evidence from studies in rats suggests that 5-HT2C receptors augment excitatory neurotransmission and are primarily located postsynaptically .

In functional studies, 5-HT2C receptor activation influences:

  • Glutamate release and neurotransmission

  • Dopamine and serotonin pathways modulation

  • Regulation of feeding behavior and metabolism

  • Modulation of anxiety and fear responses

The receptor's mRNA may undergo RNA editing events, potentially generating receptor isoforms with differing abilities to interact with G proteins and activate signaling cascades .

What is the distribution pattern of HTR2C in the canine brain?

While the specific distribution in canine brain hasn't been comprehensively mapped, studies in other species suggest that dog HTR2C would follow similar patterns:

  • High expression in the choroid plexus

  • Moderate expression in the hypothalamus, globus pallidus, and substantia nigra

  • Lower expression in the cortex and cerebellum

The receptor's distribution pattern supports its involvement in various physiological and behavioral functions including cardiorespiratory control, autonomic reflexes, and emotional regulation .

What are the optimal conditions for expressing and purifying recombinant dog HTR2C?

Recombinant dog HTR2C has been successfully expressed in yeast expression systems, achieving purities >85% as determined by SDS-PAGE . Key considerations for expression include:

Expression Systems:

  • Yeast systems are documented for dog HTR2C expression

  • Mammalian expression systems (CHO, HEK293) may provide better post-translational modifications

  • Baculovirus/insect cell systems can be considered for higher yields of functional GPCRs

Purification and Storage:

  • Store liquid form for up to 6 months at -20°C/-80°C

  • Lyophilized form maintains stability for 12 months at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Store working aliquots at 4°C for up to one week

How can I validate the functionality of recombinant dog HTR2C?

Functional validation of recombinant dog HTR2C requires multiple approaches:

Binding Assays:

  • Radioligand binding with [³H]5-HT or selective 5-HT2C ligands, similar to methods used for characterizing dog 5-HT1B receptors

  • Competition binding assays with known 5-HT2C agonists and antagonists

Functional Assays:

  • [³⁵S]GTPγS binding to assess G-protein coupling efficiency

  • Calcium mobilization assays (since 5-HT2C couples to Gq/11)

  • Inositol phosphate accumulation assays

  • Electrophysiology in cell lines expressing the receptor

Pharmacological Verification:

  • Comparison of responses to selective agonists like WAY 163909

  • Confirmation of blockade by selective antagonists such as SB242,084

  • Distinguishing 5-HT2C from 5-HT2A responses using selective antagonists like MDL100,907

What immunodetection methods are effective for studying dog HTR2C?

Based on protocols developed for other species, effective immunodetection of dog HTR2C would include:

Western Blotting:

  • Use validated anti-5-HT2C antibodies (e.g., rabbit anti-5-HT2CR, 1:750; Abcam)

  • Confirm antibody specificity through immunoblot studies and preabsorption controls

Immunohistochemistry Protocol:

  • Fix tissue appropriately (e.g., 4% paraformaldehyde)

  • Block with 10% normal donkey serum (NDS) in PBS with 0.3% Triton X-100

  • Incubate with primary antibodies against HTR2C and relevant neuronal markers

  • Include controls: primary antibody omission and preabsorption with immunizing peptide

  • Use appropriate secondary antibodies and visualization methods

Co-localization Studies:

  • Combine HTR2C antibodies with markers such as:

    • MAP-2 (dendrite marker)

    • PSD-95 (postsynaptic density protein)

    • Synaptophysin (presynaptic terminal marker)

How do genetic variations in HTR2C relate to dog domestication?

The HTR2C gene exhibits significant differences between dogs and wolves that may have contributed to behavioral changes during domestication:

  • Ten fixed SNP differences exist between dog and wolf HTR2C genes

  • HTR2C belongs to behavioral fear response categories in Gene Ontology classification

  • It interacts with HTR2A, which modulates cognitive processes through glutamate release

  • These genetic variations likely influence serotonergic and dopaminergic neurotransmission

The altered HTR2C function may have contributed to changes in fear response, aggression, and social behavior during domestication, potentially facilitating human-animal bonding .

How does RNA editing of HTR2C differ between dogs and other species?

RNA editing of HTR2C transcripts has been observed across mammalian species including humans, rodents, and pigs . While dog-specific editing patterns are not explicitly detailed in the search results, comparative biology suggests:

  • The exon encoding the second intracellular loop (which interacts with G-proteins) is subject to mRNA editing events

  • This editing can produce up to 24 potential isoforms of the protein

  • These modifications alter amino acids in positions that affect G-protein coupling efficiency

  • In pigs, the expression of the long transcriptional variant of HTR2C is elevated in animals with maternal infanticide behavior

The conservation of editing sites across mammals suggests this regulatory mechanism is functionally important and likely present in dogs as well.

What pharmacological differences exist between dog HTR2C and that of other species?

Pharmacological profiles of 5-HT2C receptors appear similar across species:

This cross-species similarity makes the dog a valuable model for translational research targeting 5-HT2C receptors for human applications.

How can PET imaging be used to investigate dog HTR2C distribution and function?

PET imaging of 5-HT2C receptors presents several challenges and opportunities:

Current Approaches:

  • Several 5-HT2C PET radiotracers have been developed, including [¹¹C]N-methylated arylazepine, [¹¹C]WAY-163909, and [¹⁸F]fluorophenylcyclopropane

  • [¹⁸F]4-(3-[¹⁸F]fluorophenethoxy)pyrimidine ([¹⁸F]4) has shown promising results for 5-HT2C receptor imaging

  • For related 5-HT2A receptors, ¹²³I-5I-R91150 has been successfully used in dogs for SPECT imaging

Protocol Considerations:

  • Intravenous injection of the radiotracer via the tail vein

  • Brain PET/CT image acquisition immediately after injection

  • 3D dynamic acquisition list mode with a micro PET/CT scanner

  • Animals maintained under anesthesia with isoflurane (2.5% flow rate)

  • Spatial normalization of images to a standard canine brain template

Validation Methods:

  • Co-administration of selective 5-HT2C ligands (e.g., lorcaserin) to verify specific binding

  • Comparison of binding in regions with known 5-HT2C expression patterns

  • Correlation with behavioral or physiological measures

What role does HTR2C play in canine behavioral disorders?

While direct evidence for HTR2C's role in canine behavioral disorders is limited in the search results, related findings suggest important functions:

  • In dogs with anxiety disorders, lower 5-HT2A receptor binding indices were found in frontal, temporal, and occipital cortices compared to normal dogs

  • Given the functional relationships between 5-HT2A and 5-HT2C receptors, HTR2C likely also influences anxiety-related behaviors

  • HTR2C is involved in serotonin and dopamine pathways that regulate emotional responses

  • Studies in other species have implicated 5-HT2C receptors in:

    • Depression and anxiety disorders

    • Compulsive behaviors

    • Impulsivity and addiction

    • Fear responses

The affected brain regions in dogs with anxiety disorders parallel those implicated in human anxiety disorders, supporting the potential of using dogs as natural models for investigating anxiety mechanisms .

How can selective 5-HT2C agonists and antagonists be used as research tools?

Selective 5-HT2C ligands provide valuable tools for investigating receptor function:

Selective Agonists:

  • WAY 163909: Selectively reduces cocaine and sucrose self-administration (ID₅₀=1.19 mg/kg and 0.7 mg/kg, respectively) and cue-induced reinstatement of cocaine-seeking (ID₅₀=0.5 mg/kg)

  • Ro60-0175: Induces hypoactivity and penile grooming at 1 mg/kg s.c.

Selective Antagonists:

  • SB242,084: Blocks hypoactivity and grooming induced by 5-HT2C agonists

  • When combined with Ro60-0175, SB242,084 unmasks 5-HT2A-mediated effects including wet-dog shakes and hyperactivity

Experimental Applications:

  • Dissection of behavioral roles of 5-HT2C vs. 5-HT2A receptors

  • Investigation of 5-HT2C involvement in feeding, reward, and addiction

  • Studying 5-HT2C modulation of anxiety and fear responses

  • Understanding interactions between 5-HT receptor subtypes

The differential effects of these compounds at different doses allow researchers to probe specific aspects of 5-HT2C function while controlling for potential effects at other receptors.

How can dog HTR2C research inform human psychiatric drug development?

Dog models offer unique advantages for translational research on 5-HT2C-targeted therapeutics:

  • Dogs naturally develop anxiety disorders with neurobiological similarities to human conditions

  • The affected brain regions in canine anxiety parallel those in human anxiety disorders

  • 5-HT2C receptors have similar pharmacological profiles across human, dog, and other mammalian species

  • Dogs provide a larger brain size than rodents for improved neuroimaging and pharmacokinetic studies

These similarities position the dog as an excellent translational model for:

  • Testing efficacy and side effect profiles of novel 5-HT2C-targeted compounds

  • Validating PET radioligands for eventual human use

  • Understanding behavioral effects of 5-HT2C modulation in complex social contexts

What therapeutic potential does HTR2C modulation have for obesity and addiction?

Research indicates significant therapeutic potential for 5-HT2C modulation:

Evidence for Metabolic Effects:

  • 5-HT2C activation reduces feeding and decreases body weight in animals and humans

  • Knockout of 5-HT2C in mice results in hyperphagia, depressed metabolic rate, and adult-onset obesity

  • Selective 5-HT2C antagonists increase baseline food intake

Evidence for Addiction Treatment:

  • 5-HT2C agonist WAY 163909 dose-dependently reduces:

    • Cocaine self-administration (ID₅₀=1.19 mg/kg)

    • Cue-induced reinstatement of cocaine-seeking (ID₅₀=0.5 mg/kg)

  • These effects occur at doses below those that impair locomotor activity

Translational Considerations:

  • Development of selective 5-HT2C agonists must avoid 5-HT2A agonism (risk of hallucinations) and 5-HT2B agonism (risk of cardiac valvulopathy)

  • Studies in dogs could help bridge preclinical rodent research and human clinical applications

What challenges exist in translating HTR2C research across species?

Despite similarities, several challenges must be addressed when translating HTR2C research:

Structural and Functional Variations:

  • Species differences in RNA editing patterns may alter receptor function

  • Ten fixed SNP differences exist between dog and wolf HTR2C genes

  • These genetic variations could influence drug binding and efficacy

Methodological Considerations:

  • Differences in pharmacokinetics and drug metabolism between species

  • Need for species-appropriate behavioral assays to measure functional outcomes

  • Ensuring antibody specificity across species for consistent immunodetection

  • Potential differences in receptor expression patterns and density

Research Strategy Recommendations:

  • Conduct comparative binding studies with recombinant receptors from multiple species

  • Validate findings across in vitro and in vivo systems

  • Consider species-specific RNA editing profiles when interpreting functional data

  • Use structurally diverse ligands to fully characterize potential species differences in binding pocket configuration

By addressing these challenges, researchers can more effectively translate findings from dog HTR2C studies to human applications in psychiatric and metabolic disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.