Recombinant Dog Adenosine receptor A2b (ADORA2B)

Shipped with Ice Packs
In Stock

Description

Pharmacological Profile

Recombinant dog ADORA2B was tested against a panel of xanthine derivatives and nonxanthine antagonists . Notable findings include:

Antagonist Binding Affinities (K<sub>i</sub> values)

CompoundDog ADORA2B K<sub>i</sub> (nM)Selectivity vs. Human ADORA2B
PSB-6032.51Comparable affinity
CVT-688315.3Moderate selectivity
MRS-17548.7Higher affinity in dog

Agonists like adenosine and NECA (5'-N-ethylcarboxamidoadenosine) activate dog ADORA2B with EC<sub>50</sub> values in the micromolar range, consistent with its low-affinity binding to adenosine .

Immune Regulation

  • Anti-inflammatory Effects: Activation of dog ADORA2B enhances regulatory T cell (Treg) differentiation, mirroring findings in murine models where ADORA2B limits inflammation via Treg upregulation .

  • Hypoxia Response: The receptor’s promoter contains HIF-1α binding sites, linking it to hypoxia-driven angiogenesis and tumor microenvironments .

Cancer Biology

  • ADORA2B is overexpressed in bladder and colorectal cancers in humans , and recombinant dog ADORA2B serves as a model for studying receptor-mediated tumor immune evasion and metastasis .

Drug Development

  • Fluorinated xanthine derivatives (e.g., PSB-603) targeting ADORA2B have been developed for positron emission tomography (PET) imaging, with dog ADORA2B used to validate ligand specificity .

Research Tools and Reagents

ToolApplicationSource
Polyclonal Antibody (bs-5900R)Western blot, immunohistochemistry Bioss
HEK293 Cell LineFunctional assays and ligand screening Cloned from dog cDNA
Radioligands (e.g., [³H]PSB-603)Binding affinity studies Custom synthesis

Comparative Insights Across Species

  • Splice Variants: A truncated rabbit ADORA2B (residues 103–111 deleted) exhibits altered signaling , highlighting the importance of species-specific studies.

  • Ligand Selectivity: Dog ADORA2B shows higher affinity for MRS-1754 than human or mouse orthologs, underscoring interspecies pharmacological variation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life can vary depending on factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ADORA2B; Adenosine receptor A2b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-332
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MQLETQDALYVALELAIAALSVAGNVLVCAAVGTSSALQTPTNYFLVSLAAADVAVGLFA IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNCTEPWDGTTNESCCLVKCLFENVVPMSY MVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRTELVDHSRTVIQREIHAAKSLAMIVG IFALCWLPVHAINCVTLFQPARAKDKPKWAMNMAILLSHASSVVNPIVYAYRNRDFRYTF HKIISRYVLCQTDVLKSGNGQAGTQSALDVGL
Uniprot No.

Target Background

Function
Adenosine receptor A2b (ADORA2B) is a receptor for adenosine. Its activity is mediated by G proteins, which activate adenylyl cyclase.
Gene References Into Functions
  1. contribution of adenosine A(2A) and A(2B) receptors to coronary reactive hyperemia and downstream K(+) channels involved PMID: 21044214
Database Links

KEGG: cfa:403410

STRING: 9615.ENSCAFP00000026712

UniGene: Cfa.112

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and basic characteristics of dog ADORA2B?

The dog Adenosine Receptor A2b (ADORA2B) is a G protein-coupled receptor encoded by the ADORA2B gene. It consists of 332 amino acids with an expected molecular mass of approximately 36.3 kDa . The receptor contains seven transmembrane domains typical of G protein-coupled receptors, with the greatest degree of homology between species occurring in these transmembrane regions. The carboxyl tail is relatively short (approximately 40 amino acids) compared to A2A receptors (approximately 70-80 amino acids) and contains a conserved putative palmitoylation site at cysteine 311 .

The dog ADORA2B shares significant structural homology with other mammalian ADORA2B receptors, particularly in the transmembrane domains, while showing more variation in the second extracellular loop and distal half of the carboxyl tail .

How does dog ADORA2B compare to ADORA2B from other species?

Dog ADORA2B shares significant structural homology with ADORA2B from other mammalian species. Among the five mammalian species with cloned ADORA2B (human, dog, rabbit, rat, and mouse), the rat and mouse ADORA2B display the greatest degree of sequence similarity (95% identical), whereas the rat and human sequences show the greatest variation (87% similarity) .

While the structural homology is high, there are notable species-specific differences in pharmacological properties. Studies comparing the binding affinity of various ligands (including xanthine derivatives and adenosine analogs) have revealed significant differences in antagonist pharmacology between species. These differences suggest that caution should be exercised when extrapolating findings from one species to another in ADORA2B research .

What signaling pathways does ADORA2B activate?

ADORA2B has the unique property among adenosine receptors of coupling to both Gs and Gq proteins, leading to the activation of multiple downstream signaling pathways. Activation of ADORA2B results in:

  • Increased intracellular cAMP levels (through Gs coupling)

  • Elevated intracellular calcium levels (through Gq coupling)

In cardiac research, ADORA2B signaling has been shown to activate the cAMP response element binding protein (CREB), which can bind to the PER2 promoter and increase its expression. This mechanism is implicated in cardioprotection during ischemia .

How can researchers effectively detect species-specific pharmacological differences in ADORA2B function?

Detecting species-specific pharmacological differences in ADORA2B requires a multi-faceted approach:

  • Radioligand binding assays: Use specific radioligands such as [³H]MRS 1754 to determine binding affinities of various ligands to ADORA2B from different species. Conduct saturation binding experiments to determine affinity (Kd) and binding capacity (Bmax) values .

  • Functional assays: Measure cAMP accumulation in response to ADORA2B activation using cAMP radioimmunoassay kits. Compare EC50 values for agonists and IC50 values for antagonists across species .

  • Recombinant expression systems: Express ADORA2B from different species in the same cell line (e.g., HEK 293 cells) to minimize differences in cellular background that might affect receptor function .

  • Cross-species pharmacological profiling: Test a panel of ligands including:

    • 1,3,8-substituted xanthine derivatives

    • Non-xanthine adenosine receptor antagonists

    • Traditional adenosine analogs

    • Substituted 6-amino-3,5-dicyano-4-phenylpyridine derivatives

By systematically comparing binding affinities and functional responses across species, researchers can identify and characterize species-specific pharmacological properties of ADORA2B.

What experimental models are suitable for studying ADORA2B function in disease contexts?

Several experimental models have been developed to study ADORA2B function in disease contexts:

  • Gene-targeted mice: Adora2b-/- knockout mice provide a powerful tool for investigating the role of ADORA2B in various pathological conditions. Studies have used these mice to examine the role of ADORA2B in liver protection from ischemia and reperfusion injury and cardiac ischemia and reperfusion injury .

  • Bone marrow transplantation models: Chimeric mice with Adora2b-/- bone marrow in wild-type recipients or wild-type bone marrow in Adora2b-/- recipients have been used to study the contribution of ADORA2B on bone marrow-derived cells versus tissue-resident cells in disease pathology .

  • Organoid models: Three-dimensional organoid cultures derived from patient samples can recapitulate in vivo architecture and molecular signatures. While dog bladder cancer organoids have been established and might be useful for studying ADORA2B in cancer contexts, specific ADORA2B organoid models need further development .

  • Cell-specific conditional knockout models: These allow for the selective deletion of ADORA2B in specific cell types, such as hepatocytes, to determine cell-specific roles of ADORA2B in disease processes .

  • Pharmacological approaches: Combining ADORA2B agonists (e.g., BAY 60-6583) or antagonists with disease models can provide insights into potential therapeutic applications .

How do ADORA2B heteromers affect receptor pharmacology and function?

ADORA2B can form heteromeric complexes with other G protein-coupled receptors, particularly with the A2A adenosine receptor (A2A-A2B heteromers). These heteromeric interactions significantly impact receptor pharmacology and function:

  • Altered ligand binding: A2A-A2B heteromerization drastically alters the pharmacology of both receptors, particularly affecting the A2A receptor component. The presence of A2B receptor protein can completely block the ligand recognition and signaling of the A2A receptor .

  • Detection methods: Several biophysical techniques can be used to detect ADORA2B heteromers:

    • Förster resonance energy transfer (FRET)

    • Bioluminescence resonance energy transfer (BRET)

    • Bimolecular fluorescence complementation (BiFC)

    • Proximity ligation assays (PLA)

  • Physiological significance: The formation of A2A-A2B heteromers is particularly important in pathological conditions where the expression of A2B is upregulated, such as under hypoxic, ischemic, and inflammatory conditions. This heteromerization may serve as a regulatory mechanism to control adenosine signaling in these contexts .

  • Experimental considerations: When studying ADORA2B function, researchers should consider the potential formation of heteromers which might affect experimental outcomes. Co-expression levels of A2A and A2B receptors should be carefully assessed in experimental systems .

What are the optimal methods for expressing and purifying recombinant dog ADORA2B?

Optimal expression and purification of recombinant dog ADORA2B requires careful consideration of expression systems, purification strategies, and quality control:

  • Expression systems:

    • HEK 293 cells: Widely used for expressing mammalian GPCRs, including dog ADORA2B, as they provide appropriate post-translational modifications and membrane insertion .

    • Stable cell lines: Generation of stable HEK 293 cell lines expressing dog ADORA2B allows for consistent receptor expression levels for experimental studies .

  • Cloning strategies:

    • Use reverse transcriptase-polymerase chain reaction (RT-PCR) from dog tissue (such as large intestine) total RNA .

    • Design primers based on conserved regions within the 5'- and 3'-untranslated regions of ADORA2B from other species .

    • Include appropriate tags (e.g., His-tag) to facilitate purification while maintaining receptor function.

  • Purification approaches:

    • Solubilize membrane fractions containing the receptor using appropriate detergents.

    • Employ affinity chromatography based on the introduced tag.

    • Consider using stabilizing agents during purification to maintain receptor conformation.

  • Quality control measures:

    • Verify receptor expression by Western blotting using specific antibodies against ADORA2B or the introduced tag .

    • Confirm receptor functionality using radioligand binding assays with [³H]MRS 1754 or other specific ligands .

    • Assess protein purity using SDS-PAGE and mass spectrometry.

What analytical methods are most effective for characterizing ADORA2B structure-function relationships?

Several analytical methods are effective for characterizing ADORA2B structure-function relationships:

  • Radioligand binding assays:

    • Saturation binding experiments with [³H]MRS 1754 to determine receptor density (Bmax) and affinity (Kd) .

    • Competition binding assays to evaluate the affinity of various ligands for the receptor .

    • Kinetic studies to determine association and dissociation rates of ligands.

  • Functional assays:

    • cAMP accumulation assays to measure Gs-mediated signaling .

    • Calcium mobilization assays to assess Gq-mediated signaling.

    • Measurements of downstream signaling pathway activation (e.g., CREB phosphorylation).

  • Mutagenesis approaches:

    • Site-directed mutagenesis to identify key residues involved in ligand binding or G protein coupling.

    • Chimeric receptor construction to identify domains responsible for species-specific pharmacological differences.

    • Analysis of naturally occurring variants (such as the rabbit A2BAR Δ103-111 splice variant) to understand structural determinants of function .

  • Biophysical methods:

    • FRET or BRET to study receptor-receptor interactions and conformational changes .

    • Proximity ligation assays (PLA) to detect receptor heteromers in native tissues .

    • Structural biology approaches (X-ray crystallography, cryo-EM) for detailed structural information when feasible.

How can researchers effectively investigate ADORA2B involvement in disease mechanisms?

To effectively investigate ADORA2B involvement in disease mechanisms, researchers can employ the following methodological approaches:

  • Expression analysis in disease states:

    • Quantify ADORA2B expression levels in diseased versus normal tissues using qRT-PCR, Western blotting, and immunohistochemistry .

    • Compare subcellular localization patterns in different disease contexts (e.g., nuclear versus cytoplasmic expression in metastatic cells) .

    • Analyze expression changes during disease progression or in response to environmental factors (e.g., hypoxia, inflammation).

  • Genetic manipulation approaches:

    • Use global or conditional Adora2b knockout models to study disease progression in the absence of receptor signaling .

    • Employ bone marrow transplantation models to distinguish between the roles of ADORA2B on hematopoietic versus non-hematopoietic cells .

    • Utilize RNA interference or CRISPR-Cas9 technology for targeted ADORA2B manipulation in specific cell types.

  • Pharmacological interventions:

    • Apply ADORA2B-specific agonists (e.g., BAY 60-6583) or antagonists in disease models to assess therapeutic potential .

    • Combination treatments with standard-of-care therapies (e.g., ADORA2B antagonists with cisplatin in cancer models) .

    • Dose-response and time-course studies to determine optimal intervention parameters.

  • Signaling pathway analysis:

    • Investigate downstream signaling pathways activated by ADORA2B in disease contexts (e.g., NF-κB pathway in gastric cancer) .

    • Examine the interplay between ADORA2B signaling and other pathways relevant to disease pathology (e.g., HIF-1α pathway under hypoxic conditions) .

    • Identify cell-specific signaling mechanisms in complex disease environments.

  • Biomarker identification:

    • Evaluate the potential of ADORA2B expression or activation as a diagnostic or prognostic biomarker .

    • Correlate ADORA2B expression levels with clinical outcomes in patient samples .

    • Develop assays to monitor ADORA2B activity in accessible patient samples (e.g., blood, urine).

What are the considerations for developing selective ADORA2B ligands for dog research models?

Developing selective ADORA2B ligands for dog research models requires careful consideration of several factors:

  • Species-specific pharmacology:

    • Consider the documented differences in binding affinity and functional response between species when selecting or designing ligands .

    • Validate the selectivity and potency of ligands specifically in dog ADORA2B systems rather than assuming cross-species consistency.

  • Receptor selectivity profiling:

    • Test candidate ligands against all four adenosine receptor subtypes (A1, A2A, A2B, A3) from dogs to ensure subtype selectivity.

    • Consider potential cross-reactivity with other G protein-coupled receptors.

  • Structure-activity relationship studies:

    • Develop and test structure-activity relationships specifically for dog ADORA2B.

    • Consider the amino acid differences in binding regions compared to other species when designing ligands.

  • Formulation for in vivo studies:

    • Optimize solubility, stability, and bioavailability for in vivo applications.

    • Consider pharmacokinetic properties specific to dogs (absorption, distribution, metabolism, excretion).

  • Experimental validation approaches:

    • Use recombinant dog ADORA2B expressed in cell lines for initial screening .

    • Validate in primary dog cells and tissues to account for the natural cellular environment.

    • Confirm selectivity using radioligand binding competition assays with [³H]MRS 1754 .

    • Verify functional activity using cAMP accumulation assays or other functional readouts .

How can recombinant dog ADORA2B be utilized in comparative oncology research?

Recombinant dog ADORA2B offers valuable opportunities for comparative oncology research:

  • Bladder cancer models:

    • Dog bladder cancer resembles human muscle-invasive bladder cancer in histopathological characteristics and gene expression profiles, making it an important research model .

    • ADORA2B is among the genes upregulated in bladder cancer organoids compared to normal bladder tissues (approximately 155-fold increase), suggesting potential relevance in cancer biology .

    • Table data from RNA-seq analysis shows ADORA2B expression levels:

    Tissue/SampleADORA2B ExpressionFold increase (relative to normal)
    Normal bladder0.61.0
    Organoid 115.826.3
    Organoid 288.8148.0
    Organoid 3107.5179.2
    Organoid 4135.9226.5
    Average in organoids87.0155.0

    (Data adapted from Table 3)

  • Gastric cancer applications:

    • ADORA2B expression is significantly higher in gastric cancer tissue compared to normal tissue (76.0% vs 5.3% positive rate) .

    • ADORA2B expression is further elevated in metastatic tissues, particularly in the nucleus, suggesting a role in cancer progression and metastasis .

    • Antagonizing ADORA2B can reduce gastric cancer cell invasion and migration, and enhance the effectiveness of chemotherapy agents like cisplatin .

  • Research methodology approaches:

    • Establish dog cancer cell lines or patient-derived organoids expressing ADORA2B for drug screening .

    • Develop selective ADORA2B antagonists and evaluate their anti-cancer effects in dog cancer models .

    • Use comparative genomics and proteomics to identify conserved ADORA2B-related pathways between human and dog cancers.

What role does ADORA2B play in ischemia-reperfusion injury, and how can this be studied using recombinant proteins?

ADORA2B plays a critical role in protecting tissues from ischemia-reperfusion injury through multiple mechanisms:

  • Hepatic protection mechanisms:

    • ADORA2B transcript and protein levels are selectively induced during human liver transplantation (over 10-fold induction compared to other adenosine receptors) .

    • ADORA2B signaling in hepatocytes inhibits hypoxic NF-κB activation, reducing inflammatory responses and subsequent tissue damage .

    • Adora2b-/- mice experience more severe hepatic ischemia-reperfusion injury, while ADORA2B agonist treatment is protective .

  • Cardiac protection mechanisms:

    • ADORA2B signaling on bone marrow-derived cells, particularly polymorphonuclear leukocytes (PMNs), dampens myocardial ischemia-reperfusion injury .

    • Transplantation of Adora2b-/- bone marrow into wild-type mice increases infarct sizes and cardiac damage markers (e.g., Troponin-I) .

    • ADORA2B signaling reduces tumor-necrosis-factor-α release from PMNs, thereby limiting inflammatory tissue damage .

    • ADORA2B activation induces Per2 (Period 2) expression through CREB-dependent mechanisms, promoting a HIF-dependent metabolic adaptation that enhances glycolytic capacity during ischemia .

  • Research approaches using recombinant proteins:

    • Express recombinant dog ADORA2B in cell culture systems to study receptor signaling mechanisms under hypoxic conditions.

    • Use purified recombinant ADORA2B for structural studies and ligand binding assays to develop selective agonists for therapeutic applications.

    • Employ recombinant ADORA2B in protein-protein interaction studies to identify novel binding partners involved in protective signaling pathways.

    • Develop screening assays with recombinant ADORA2B to identify compounds that enhance receptor activity or downstream signaling during ischemic conditions.

What are the implications of ADORA2B splice variants for research and therapeutic development?

The discovery of ADORA2B splice variants has significant implications for research and therapeutic development:

  • Identified splice variants:

    • A rabbit ADORA2B splice variant (A2BAR Δ103-111) lacking amino acids 103-111 in the second intracellular loop has been identified .

    • This variant results from the use of an alternative 5' donor site that is present in rabbit and dog ADORA2B sequences but not in human, rat, or mouse sequences .

    • The 9-amino acid deletion occurs near the only known splice junction of ADORA2B, which is located within the highly conserved DRY motif implicated in G protein coupling and receptor stabilization .

  • Functional consequences:

    • The A2BAR Δ103-111 variant showed impaired cell surface expression compared to the full-length receptor, with less distinct plasma membrane localization .

    • Despite preserving the DRY motif, the variant exhibited compromised functionality, highlighting the importance of the deleted region for proper receptor function .

    • Expression of the variant appears to be tissue-specific, with detectable levels in rabbit brain but not in other tissues where ADORA2B is abundantly expressed (spleen, small intestine, large intestine) .

  • Research implications:

    • Investigators should consider the potential presence of splice variants when studying ADORA2B function, particularly in rabbits and potentially dogs.

    • Expression analysis methods should be designed to detect both full-length receptors and potential splice variants.

    • Functional studies should assess whether splice variants might act as dominant-negative regulators of full-length receptor function.

  • Therapeutic development considerations:

    • Drugs targeting ADORA2B should be evaluated for efficacy against both full-length receptors and relevant splice variants.

    • Species differences in splice variant expression may affect the translatability of preclinical findings to human applications.

    • Tissue-specific expression of splice variants might offer opportunities for targeted therapeutic approaches.

How can heteromeric interactions of ADORA2B with other receptors influence experimental design and interpretation?

Heteromeric interactions of ADORA2B with other receptors, particularly A2A adenosine receptors, have profound implications for experimental design and interpretation:

  • Demonstration of heteromer formation:

    • A2A-A2B heteromeric complexes have been confirmed using multiple complementary techniques:

      • Förster resonance energy transfer (FRET)

      • Bioluminescence resonance energy transfer (BRET)

      • Bimolecular fluorescence complementation (BiFC)

      • Proximity ligation assays (PLA)

    • Heteromer formation occurs independently of agonist or antagonist presence and does not require the long C-terminus of the A2A receptor .

  • Altered pharmacological properties:

    • A2A-A2B heteromerization dramatically alters the pharmacology of both receptors, with particularly pronounced effects on the A2A component .

    • The presence of A2B receptor protein can completely block ligand recognition and signaling of the A2A receptor .

    • These effects must be considered when interpreting pharmacological studies in systems where both receptors are expressed.

  • Experimental design considerations:

    • Characterize the expression levels of both A2A and A2B receptors in experimental systems (cell lines, tissues).

    • Consider the A2A:A2B expression ratio, as this may determine the extent of heteromerization and its functional consequences.

    • Include appropriate controls with single receptor expression when studying pharmacological properties.

    • Evaluate the potential formation of heteromers with proximity-based assays (FRET, BRET, PLA) in your experimental system.

  • Interpretation frameworks:

    • In systems with co-expression of A2A and A2B receptors, interpret pharmacological data with consideration of potential heteromeric effects.

    • Unexpected pharmacological responses might be explained by heteromer formation rather than by atypical single receptor behavior.

    • Consider that pathological conditions that alter the expression levels of one receptor might indirectly affect the function of the other through changes in heteromerization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.