Recombinant Dog Aquaporin-2 (AQP2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
AQP2; Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-109
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
AQP2
Target Protein Sequence
SVAFSRAVFAEFLATLLFVFFGLGSALNWPQALPSVLQIAMAFGLGIGTLVQALGHVSGAHINPAVTVACLVGCHVSFLRAAFYVAAQLLGAVAGAALLHEITPPHVRG
Uniprot No.

Target Background

Function
Aquaporin-2 (AQP2) forms a water-specific channel that provides the plasma membranes of renal collecting duct with high permeability to water. This enables water to move along an osmotic gradient.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Apical cell membrane; Multi-pass membrane protein. Basolateral cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Golgi apparatus, trans-Golgi network membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of canine AQP2?

Canine Aquaporin-2 is a homotetrameric water channel protein primarily expressed in the collecting ducts of the kidney, where it plays a critical role in water homeostasis. Similar to human AQP2, dog AQP2 is essential for the concentration of urine and is regulated by the antidiuretic hormone vasopressin. The protein is selectively permeable to water molecules while remaining impermeable to ions or other small molecules . Functionally, canine AQP2 is localized in both the basolateral and apical membranes of principal cells in the collecting duct, facilitating water reabsorption when activated. This protein exhibits a single channel water permeability of approximately 0.93±0.03×10^-13 cm³/s, similar to other aquaporins . The dysregulation of AQP2 in dogs has been associated with polyuria in chronic kidney disease (CKD), making it a clinically relevant protein for veterinary medicine .

What expression systems are most effective for producing functional recombinant dog AQP2?

The baculovirus/insect cell system has proven highly effective for expressing functional recombinant AQP2. This system enables large-scale production of correctly folded, functional protein that maintains its native homotetrameric structure. Researchers have successfully used this approach to generate his-tagged AQP2 (HT-AQP2) at yields of approximately 0.5 mg of pure protein per liter of bioreactor culture . The expressed protein retains proper water permeability characteristics, making it suitable for structural and functional studies.

For mammalian expression, the Flp-In T-REx Madin-Darby canine kidney (MDCK) cell system offers advantages for studying AQP2 regulation. This system allows for temporal and quantitative control of AQP2 expression levels, enabling researchers to induce expression without protein aggregation and to observe correct translocation in response to elevated cAMP . This approach is particularly valuable for time-lapse imaging studies examining protein trafficking dynamics.

How is canine AQP2 regulated by vasopressin, and what signaling pathways are involved?

Canine AQP2 regulation by vasopressin follows similar mechanisms to those observed in other species. When the body experiences dehydration, vasopressin is secreted from the posterior pituitary gland and binds to the vasopressin V2 receptor (AVPR2) on the basolateral membrane of principal cells in the renal collecting duct . This binding initiates a signaling cascade involving:

  • Activation of adenylyl cyclase

  • Increased intracellular cAMP production

  • Activation of protein kinase A (PKA)

  • Phosphorylation of AQP2, particularly at serine-256

  • Translocation of AQP2 from intracellular vesicles to the apical membrane

This process increases water permeability of the collecting duct by a factor of 10-100, dramatically enhancing water reabsorption . When vasopressin stimulation ceases, AQP2 is internalized back into the cytoplasm through endocytosis, returning the cell to a water-impermeable state . Recent research has also identified alternative pathways, such as Src-mediated phosphorylation of AQP2 at serine-269, which can promote apical membrane accumulation independently of the vasopressin/serine-256 pathway .

What are the key phosphorylation sites in dog AQP2 and their functional significance?

Canine AQP2 contains several functionally important phosphorylation sites that regulate its trafficking and retention in the plasma membrane:

Phosphorylation SiteFunctional RoleRegulation Mechanism
Serine-256Primary site for vasopressin-mediated traffickingPKA-dependent phosphorylation following cAMP elevation promotes translocation to the apical membrane
Serine-269Enhances plasma membrane retentionPhosphorylation potentiates plasma membrane retention of AQP2 following vasopressin stimulation

Phospho-mimicking mutations demonstrate these distinct roles: AQP2-S256A (preventing phosphorylation) results in primarily intracellular localization, while AQP2-S256D (mimicking phosphorylation) promotes plasma membrane localization . This phosphorylation-dependent regulation is critical for the dynamic control of AQP2 function in response to changing physiological conditions.

What methodological approaches are most effective for studying canine AQP2 trafficking in real-time?

Real-time analysis of canine AQP2 trafficking requires specialized methodological approaches:

  • Inducible Expression Systems: The Flp-In T-REx MDCK cell system enables controlled expression of AQP2 and phospho-mimicking mutants, avoiding artifacts from overexpression. This system allows temporal and quantitative control of AQP2 expression, essential for studying physiological trafficking processes .

  • Fluorescent Protein Tagging: Enhanced green fluorescent protein (EGFP)-tagged AQP2 enables visualization without disrupting normal trafficking. The optimal approach involves induction of untagged AQP2 expression combined with transient, low expression of EGFP-tagged AQP2, which prevents aggregation while maintaining proper cAMP-responsive translocation .

  • Time-lapse Imaging: This technique has revealed important dynamics of AQP2-containing endosomes. For example, researchers have observed AQP2-containing tubulating endosomes, with tubulation significantly decreasing 30 minutes after cAMP elevation. This approach has also demonstrated differences between phospho-mimicking mutants, where AQP2-S256A-containing endosomes tubulate while AQP2-S256D-containing endosomes do not .

  • Phospho-specific Antibodies: Antibodies targeting specific phosphorylation sites (such as Ser-269) allow researchers to track the phosphorylation state of AQP2 during trafficking events .

These methodologies collectively enable researchers to visualize and quantify the complex dynamics of AQP2 trafficking in response to stimuli like vasopressin or cAMP elevation.

How can researchers effectively study the relationship between canine AQP2 and AVPR2 in kidney disorders?

Studying the relationship between AQP2 and AVPR2 in canine kidney disorders requires a multifaceted approach:

  • Immunohistochemical Analysis: This technique allows researchers to simultaneously visualize and quantify the expression and localization of both AQP2 and AVPR2 in kidney tissue. In dogs with chronic kidney disease (CKD), both proteins show markedly decreased expression compared to healthy dogs .

  • Double-labeling Techniques: Researchers can use specific antibodies to simultaneously detect AQP2 and AVPR2, revealing their co-localization patterns. This approach has demonstrated that AVPR2 is primarily expressed in the basolateral membrane of principal cells in the collecting duct of both the renal cortex and medulla .

  • Quantitative Image Analysis: Mann-Whitney U-tests or similar statistical analyses can be applied to quantify differences in protein expression between normal and diseased kidney tissues .

  • Correlation Analysis: Establishing correlations between AQP2/AVPR2 expression levels and clinical parameters (such as urine concentration ability) helps elucidate the functional consequences of altered expression in disease states.

  • Comparative Studies: Examining similarities and differences between canine models and human disease can provide translational insights, considering that canine kidneys differ structurally from human kidneys (being unipyramidal) .

These approaches have revealed that CKD in dogs is associated with markedly decreased expression of both AQP2 and AVPR2, which correlates with the polyuria observed in this condition .

What strategies can be employed to develop specific inhibitors or activators of canine AQP2?

Development of specific modulators of canine AQP2 requires several strategic approaches:

  • Structural Analysis: Obtaining high-resolution structures of canine AQP2 is essential for structure-based drug design. The baculovirus/insect cell expression system has successfully produced sufficient quantities of functional AQP2 suitable for structural studies . This approach yields approximately 0.5 mg of pure protein per liter of culture, which can be used for crystallography or cryo-electron microscopy.

  • Direct AQP2 Targeting: Targeting AQP2 directly, rather than upstream regulators like vasopressin receptors, offers increased specificity for treating water balance disorders. Current treatments like the vasopressin V2 receptor antagonist tolvaptan affect multiple downstream pathways beyond AQP2 function, which may limit their effectiveness in improving long-term outcomes .

  • Phosphorylation Site Targeting: Developing compounds that modulate specific phosphorylation sites represents a promising approach. For example, targeting the Src-dependent phosphorylation of serine-269, which promotes AQP2 apical membrane accumulation independently of vasopressin signaling, could provide novel therapeutic avenues .

  • Trafficking Modulators: Compounds that specifically affect the exocytosis or endocytosis of AQP2-containing vesicles could offer targeted control of water reabsorption. Time-lapse imaging studies revealing the dynamics of AQP2-containing tubulating endosomes provide potential targets for such interventions .

  • High-throughput Screening: Establishing functional assays using the Flp-In T-REx MDCK cell system with controlled expression of AQP2 enables screening of compound libraries for modulators of AQP2 trafficking or function .

These approaches could lead to the development of more specific and effective treatments for water balance disorders in both veterinary and human medicine.

What are the methodological considerations for studying AQP2 regulation in chronic kidney disease models?

When investigating AQP2 regulation in chronic kidney disease (CKD) models, researchers should consider:

  • Tissue Collection and Processing: Kidney tissue should be collected promptly following euthanasia and processed appropriately for immunohistochemistry to preserve protein localization and expression patterns. Paraffin embedding and sectioning at consistent thicknesses (typically 4-6 μm) are recommended for reproducible results .

  • Antibody Selection and Validation: Using well-characterized antibodies specific for canine AQP2 is crucial. Antibodies should be validated for specificity in canine tissues, as cross-reactivity with other aquaporins may confound results. For phosphorylation studies, phospho-specific antibodies targeting sites like Ser-256 or Ser-269 provide more detailed insights into regulatory mechanisms .

  • Controls and Comparative Analysis: Including both healthy kidney tissue and different stages of CKD is essential for identifying disease-specific changes. When possible, longitudinal sampling can reveal progressive changes in AQP2 expression and distribution .

  • Multiple Detection Methods: Combining immunohistochemistry with other techniques such as western blotting, PCR, or in situ hybridization provides a more comprehensive understanding of AQP2 dysregulation at protein and transcript levels .

  • Functional Correlations: Correlating molecular findings with clinical parameters of kidney function (e.g., urine concentration ability, polyuria severity) strengthens the translational relevance of the research .

  • Regional Analysis: Examining AQP2 expression in different kidney regions (cortex vs. medulla) and within specific nephron segments is important, as CKD may differentially affect these areas .

These methodological considerations enable researchers to generate reliable data on AQP2 dysregulation in CKD, contributing to better understanding of disease mechanisms and potential therapeutic targets.

How can researchers investigate the role of exosomes in AQP2 regulation and kidney function?

Investigating AQP2 in exosomes requires specialized methodological approaches:

  • Exosome Isolation: Techniques for isolating exosomes from urine include differential ultracentrifugation, density gradient centrifugation, and immunoaffinity capture using exosome-specific markers. Each method has different purity and yield characteristics that should be considered based on downstream applications .

  • AQP2 Detection in Exosomes: Western blotting with AQP2-specific antibodies can confirm the presence of AQP2 in urinary exosomes. Multiple AQP2 bands are typically observed due to different glycosylation states and proteolytic processing, with the primary bands appearing at approximately 29-37 kDa .

  • Quantitative Analysis: Comparing exosomal AQP2 levels between normal and disease states can reveal alterations in AQP2 secretion. This approach has demonstrated that AQP2 abundance in a collecting duct cell is determined by a balance between production via translation and removal via degradation and/or secretion into urine in exosomes .

  • Functional Studies: Investigating whether exosomal AQP2 remains functional or can transfer functional properties to recipient cells provides insights into potential paracrine signaling roles of exosomal AQP2.

  • Correlation with Cellular AQP2: Examining the relationship between cellular AQP2 levels and exosomal AQP2 secretion helps determine whether exosome secretion represents a significant regulatory mechanism for cellular AQP2 abundance. This is particularly relevant in conditions like polyuria and SIADH where AQP2 regulation is disrupted .

What are the optimal immunodetection methods for studying phosphorylated forms of canine AQP2?

Optimal immunodetection of phosphorylated canine AQP2 requires careful methodological consideration:

  • Phospho-specific Antibodies: Antibodies specifically targeting phosphorylated residues, such as Ser-256 or Ser-269, are essential. These antibodies should be validated for both specificity to the phosphorylated epitope and cross-reactivity with canine AQP2. For example, antibodies like anti-Aquaporin 2 (Ser269) have been developed and validated for detecting phosphorylated AQP2 across species including human, mouse, and rat .

  • Sample Preparation: Phosphoproteins are susceptible to dephosphorylation by endogenous phosphatases. Samples should be collected and processed with phosphatase inhibitors (e.g., sodium fluoride, sodium orthovanadate, β-glycerophosphate) to preserve phosphorylation states .

  • Detection Techniques:

    • Western Blotting: Optimal for quantitative analysis of total phosphorylated AQP2, typically detecting bands at 29-37 kDa depending on glycosylation state

    • Immunohistochemistry (IHC): Enables visualization of the spatial distribution of phosphorylated AQP2 within kidney tissue sections

    • Immunocytochemistry (ICC): Useful for cellular localization studies, especially in controlled cell systems like the Flp-In T-REx MDCK cells

    • Immunoprecipitation (IP): Can be used to enrich for phosphorylated AQP2 prior to detection by other methods

  • Controls: Include both positive controls (tissues or cells with known AQP2 phosphorylation) and negative controls (phosphatase-treated samples or tissues from AQP2-knockout animals). Phospho-mimicking mutants (S256D) and phospho-deficient mutants (S256A) serve as valuable controls for specificity testing .

These methodological approaches ensure reliable detection and quantification of phosphorylated AQP2, enabling accurate assessment of its regulation in various physiological and pathological conditions.

What experimental approaches can differentiate between trafficking defects and functional defects in mutant canine AQP2?

Distinguishing between trafficking and functional defects in mutant canine AQP2 requires a systematic experimental approach:

  • Cellular Localization Studies:

    • Confocal Microscopy: Using fluorescently tagged AQP2 or immunofluorescence with AQP2-specific antibodies to determine subcellular localization (intracellular vesicles vs. plasma membrane)

    • Membrane Fractionation: Biochemical separation of plasma membrane and intracellular compartments followed by western blotting for AQP2

    • Surface Biotinylation: Selective labeling of cell surface proteins to quantify plasma membrane AQP2

  • Trafficking Dynamics Assessment:

    • Time-lapse Imaging: Observing EGFP-tagged AQP2 in response to stimuli like cAMP elevation can reveal trafficking defects in real-time

    • Endosome Tubulation Analysis: Quantifying tubulation of AQP2-containing endosomes, which significantly decreases 30 minutes after cAMP elevation in normal AQP2 but may be altered in mutants

    • Comparison with Phospho-mimicking Mutants: Using S256A (predominantly intracellular) and S256D (predominantly membrane-localized) as references for trafficking phenotypes

  • Functional Water Transport Assays:

    • Water Permeability Measurements: Using techniques like stopped-flow light scattering to measure the rate of water movement across membranes containing wild-type or mutant AQP2

    • Single Channel Water Permeability: Quantifying water transport at the single channel level (e.g., 0.93±0.03×10^-13 cm³/s for normal AQP2)

    • Osmotic Challenge Tests: Assessing cellular volume changes in response to osmotic gradients as a measure of functional water transport

  • Structure-Function Analysis:

    • Tetramerization Assessment: Native PAGE or crosslinking studies to determine if mutations affect the formation of the homotetrameric structure essential for AQP2 function

    • Molecular Dynamics Simulations: Computational modeling of how mutations affect the water channel structure and predicted water flow rates

By combining these approaches, researchers can determine whether a mutation primarily affects trafficking to the plasma membrane, the intrinsic water transport function, or both aspects of AQP2 biology.

How can CRISPR-Cas9 technology be applied to study canine AQP2 regulation in vitro?

CRISPR-Cas9 technology offers powerful approaches for studying canine AQP2 regulation:

  • Gene Knockout Studies:

    • Complete elimination of AQP2 expression in MDCK cells to create clean cellular models for reconstitution experiments

    • Knockout of specific regulatory genes in the vasopressin-AQP2 pathway to dissect signaling mechanisms

    • Creation of isogenic cell lines differing only in AQP2 status for precise comparative studies

  • Precise Mutation Introduction:

    • Generation of phospho-deficient mutations (e.g., S256A, S269A) to study the role of specific phosphorylation sites

    • Introduction of disease-associated mutations identified in canine patients with water balance disorders

    • Creation of tagged versions of endogenous AQP2 (e.g., EGFP-AQP2) expressed from the native locus to avoid overexpression artifacts

  • Regulatory Element Editing:

    • Modification of promoter or enhancer regions to study transcriptional regulation of AQP2

    • Introduction of reporter genes downstream of the AQP2 promoter to monitor transcriptional activity

    • Creation of inducible systems using modified regulatory elements for temporal control of expression

  • Base Editing Applications:

    • Precise modification of single nucleotides to study the effects of naturally occurring SNPs on AQP2 function

    • Introduction of specific codon changes without double-strand breaks, reducing off-target effects

  • Temporal Control Systems:

    • Integration of CRISPR-Cas9 with inducible systems like the Flp-In T-REx system for temporal and quantitative control of gene editing

    • Development of optogenetic or chemically inducible CRISPR systems for studying dynamic aspects of AQP2 regulation

These CRISPR-based approaches enable unprecedented precision in manipulating the AQP2 gene and its regulatory elements, facilitating detailed mechanistic studies of canine AQP2 regulation.

What are the latest findings on the role of AQP2 in canine kidney disease progression?

Recent research has revealed important insights into AQP2's role in canine kidney disease:

  • Expression Patterns in CKD: Immunohistochemical studies have demonstrated a marked decrease in both AQP2 and AVPR2 expression in dogs with chronic kidney disease compared to healthy controls. This reduction correlates with the development of polyuria, suggesting a mechanistic link between AQP2 dysregulation and impaired water reabsorption in CKD .

  • Localization Changes: In healthy canine kidneys, AQP2 is strongly expressed in both the basolateral and apical membranes of principal cells in the collecting duct, throughout both the renal cortex and medulla. In contrast, dogs with CKD show significantly reduced AQP2 expression in these regions, potentially contributing to water homeostasis disruption .

  • Relationship with AVPR2: The parallel reduction in AVPR2 expression in canine CKD suggests a coordinated dysregulation of the vasopressin-AQP2 axis. This finding indicates that therapeutic approaches may need to target both proteins or their shared regulatory pathways to effectively manage water balance disorders in CKD .

  • Comparative Aspects: While the structure of canine kidneys differs from human kidneys (being unipyramidal), the molecular mechanisms of AQP2 regulation and its role in water homeostasis appear conserved. This suggests that findings in canine models may have translational relevance for human kidney diseases .

  • Potential Therapeutic Implications: The identification of AQP2 dysregulation in canine CKD provides a rationale for developing targeted therapies aimed at restoring normal AQP2 expression or function. Such approaches could potentially address the polyuria commonly observed in dogs with kidney disease .

These findings highlight the importance of AQP2 in canine kidney disease and suggest that targeting AQP2 regulation may offer new therapeutic avenues for managing water balance disorders in veterinary medicine.

What are the most significant unsolved questions in canine AQP2 research?

Despite considerable progress, several critical questions remain in canine AQP2 research:

  • Species-Specific Regulation: How does the regulation of canine AQP2 differ from that in humans and other species? While core mechanisms appear conserved, there may be species-specific aspects of AQP2 regulation that remain undiscovered, particularly given the structural differences between canine and human kidneys .

  • Degradation Mechanisms: What are the precise mechanisms controlling AQP2 degradation versus recycling in canine kidney cells? Understanding this balance is crucial as AQP2 abundance is determined by the interplay between production, degradation, and secretion in exosomes .

  • Transcriptional Regulation: What transcription factors and regulatory elements control canine AQP2 gene expression? While vasopressin is known to increase AQP2 transcription, the specific transcriptional machinery involved in dogs remains poorly characterized .

  • Interactome Composition: What proteins interact with canine AQP2 to regulate its trafficking, function, and stability? A comprehensive characterization of the AQP2 interactome in dogs could reveal novel regulatory mechanisms and therapeutic targets.

  • Disease-Specific Alterations: How is AQP2 dysregulated in different canine kidney diseases beyond CKD? Understanding disease-specific alterations could enable more targeted therapeutic approaches for conditions like congenital nephrogenic diabetes insipidus in dogs.

  • Therapeutic Targeting: Can direct targeting of AQP2 (rather than upstream regulators like vasopressin receptors) provide more effective treatments for canine water balance disorders? Development of canine-specific AQP2 modulators represents an important frontier in veterinary medicine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.