Recombinant Dog Beta-1 adrenergic receptor (ADRB1)

Shipped with Ice Packs
In Stock

Description

Introduction to Dog Beta-1 Adrenergic Receptor

Beta-1 adrenergic receptor belongs to a prototypic family of guanine nucleotide binding regulatory protein-coupled receptors (GPCRs) that mediate the physiological effects of the hormone epinephrine and the neurotransmitter norepinephrine . In dogs, this receptor is also known by alternative nomenclature including Beta-1 adrenoreceptor and Beta-1 adrenoceptor . The receptor is predominantly located in the heart, where it serves as a primary regulator of cardiac function .

The canine ADRB1 plays a crucial role in mediating catecholamine-induced activation of adenylate cyclase through the action of G proteins, binding both epinephrine and norepinephrine with approximately equal affinity . This signaling pathway is essential for normal cardiovascular function in dogs, making ADRB1 an important target for research into cardiac physiology and pathology.

Expression Systems

Recombinant dog ADRB1 protein is commonly expressed in bacterial systems, particularly Escherichia coli (E. coli) . This expression system allows for cost-effective production of significant quantities of the receptor protein for research applications. The recombinant protein can be produced in both full-length and partial forms depending on the specific research requirements .

Functional Role of Dog ADRB1 in Cardiovascular Health

The Beta-1 adrenergic receptor plays a pivotal role in regulating canine cardiovascular function. It serves as a valuable biomarker for studying cardiovascular diseases and treatment responses in dogs . When activated by catecholamines like epinephrine and norepinephrine, ADRB1 initiates signaling cascades that influence heart rate, contractility, and other aspects of cardiac function.

This receptor interacts with various proteins including GOPC, MAGI3, and DLG4, forming signaling complexes that regulate downstream pathways . These interactions are crucial for normal cardiac function and may be altered in various pathological conditions, making them important targets for therapeutic interventions.

Genetic Polymorphisms and Their Impact on ADRB1 Function

Recent research has identified significant genetic variations in the canine ADRB1 gene that have functional consequences. Specifically, two deletion polymorphisms have been discovered that alter both the structure and function of the ADRB1 protein .

In a study involving 18 healthy adult dogs, 11 with ADRB1 deletions and 7 without (controls), researchers evaluated the impact of these genetic variations on heart rate response to the β-adrenergic receptor antagonist atenolol . Computer modeling predicted that these deletions would alter the structure of the ADRB1 protein, and functional testing confirmed this prediction .

The research findings demonstrated that dogs with ADRB1 deletions had lower baseline heart rates compared to control dogs without the deletions . The average heart rates were significantly lower in dogs with the deletions, indicating that these genetic variations have a measurable physiological impact .

These findings have important implications for veterinary medicine, suggesting that individual genome-based treatment recommendations could significantly impact the management of dogs with heart disease . This represents a step toward personalized medicine in veterinary cardiology, where treatments could be tailored based on a dog's specific ADRB1 genotype.

ELISA Kits for ADRB1 Detection

Enzyme-linked immunosorbent assay (ELISA) kits specifically designed for the accurate detection of ADRB1 levels in canine samples are valuable research tools. These kits enable the measurement of ADRB1 in various sample types including serum, plasma, tissue homogenates, cell culture supernatants, and other biological fluids .

The Dog Beta-1 Adrenergic Receptor ELISA Kit offers high sensitivity and specificity for detecting both natural and recombinant dog ADRB1, making it suitable for a variety of research applications . By accurately measuring ADRB1 levels in canine samples, researchers can gain insight into the role of this receptor in various physiological processes and disease states.

Applications in Pharmaceutical Research

Beta-adrenergic receptor antagonists (beta-blockers) are widely utilized for the management of cardiac diseases in dogs . Recombinant dog ADRB1 provides a valuable tool for studying the interactions between these drugs and their target receptor, potentially leading to the development of more effective and targeted therapies.

Research using recombinant dog ADRB1 can help elucidate the mechanisms of action of various cardiovascular drugs and predict their efficacy in dogs with different genetic backgrounds. This approach supports the development of precision veterinary medicine, where treatments are tailored to individual patients based on their genetic profile.

Future Directions in Dog ADRB1 Research

The discovery of functionally significant polymorphisms in the canine ADRB1 gene opens new avenues for research. Future studies may focus on identifying additional genetic variations and their functional consequences, developing genetic tests to identify dogs with specific ADRB1 variants, and designing personalized treatment protocols based on these genetic profiles.

Additional research may also explore the role of ADRB1 in conditions beyond cardiovascular diseases, as adrenergic signaling is involved in various physiological processes. The development of more sophisticated recombinant ADRB1 variants and assay systems will continue to advance our understanding of this important receptor in canine health and disease.

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will prepare it according to your request.
Lead Time
The delivery time may vary depending on the purchasing method and location. For specific delivery information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotation for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type in mind, please communicate your preference, and we will prioritize development of the specified tag.
Synonyms
ADRB1; Beta-1 adrenergic receptor; Beta-1 adrenoreceptor; Beta-1 adrenoceptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-473
Protein Length
Full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MGAGALALGASEPCNLSSAAPLPDGAATAARLLVPASPSASPLAPTSEGPAPLSQQWTAG IGLLMALIVLLIVAGNVLVIAAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVM RGRWEYGSFLCELWTSVDVLCVTASIETLCVIALDRYLAITAPFRYQSLLTRARARALVC TVWAISALVSFLPILMHWWRAGGDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPAPPPAPAPAPPPAPGSPRPAAAAPLAN GRVGRRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRDLVPDRLFVFFN WLGYANSAFNPIIYCRSPDFRRAFQRLLCCARRAARGSHGAAGDPPRARPPPSPGAASDD DDDDEDDAGAGAGAAPPARLLEPWAGCNGGAAADSDSSLDGAGSPAGASESRV
Uniprot No.

Target Background

Function
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. It facilitates Ras activation through G(s)-alpha- and cAMP-mediated signaling. Additionally, it plays a role in the regulation of sleep/wake behaviors.
Database Links
Protein Families
G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome.

Q&A

What is the primary function of beta-1 adrenergic receptors in dogs?

Beta-1 adrenergic receptors in dogs function primarily to mediate catecholamine-induced activation of adenylate cyclase through the action of G proteins. They play a crucial role in regulating heart rate and cardiovascular function, making them valuable biomarkers for studying cardiovascular diseases and treatment responses . Functionally, these receptors bind epinephrine and norepinephrine with approximately equal affinity, initiating intracellular signaling cascades that regulate cardiac contractility and chronotropy . While beta-1 receptors are located primarily in cardiac muscle, they are also present in skeletal muscle, creating a complex physiological response network . As G protein-coupled receptors, they feature the characteristic seven-transmembrane domain structure and trigger multiple downstream signaling pathways essential for normal cardiac function and adaptation to stress.

What are the primary signaling pathways associated with dog beta-1 adrenergic receptors?

Dog beta-1 adrenergic receptors initiate several key signaling pathways critical for cardiovascular function. The primary pathway involves the activation of adenylate cyclase through G proteins, particularly Gs, leading to increased intracellular cAMP levels . ADRB1 also mediates Ras activation through G(s)-alpha and cAMP-mediated signaling cascades . These pathways ultimately control cardiac contractility, heart rate, and other cardiovascular parameters. Methodologically, researchers investigating these pathways should employ combination approaches including receptor binding assays, cAMP accumulation assays, calcium flux measurements, and downstream protein phosphorylation analyses. Another important consideration is the potential crosstalk with other signaling pathways, as ADRB1 interactions with proteins like GOPC, MAGI3, and DLG4 suggest complex regulatory networks that may influence receptor trafficking, localization, and signaling efficiency in cardiovascular tissues.

What genetic variants have been identified in canine ADRB1 and how might they affect receptor function?

Research has identified specific genetic variations in the canine ADRB1 gene with potential functional implications. A key study examining DNA from five dog breeds discovered two significant deletions within the region of the gene that encodes the cytoplasmic tail of ADRB1 . This region plays an important role in differentiating subtypes of adrenergic receptors and may be involved in controlling receptor downregulation . These genetic variations could significantly impact receptor function by altering signaling efficiency, receptor trafficking, or response to pharmacological agents. Methodologically, researchers investigating these variants should consider using targeted sequencing approaches combined with functional assays to assess the impact of these deletions on receptor activity. Additionally, breed-specific differences in these variants may contribute to varied cardiovascular disease susceptibilities and responses to beta-adrenergic receptor antagonists, similar to what has been observed in humans where genetic variability in ADRB1 is associated with variable responses to beta-blockers .

How can researchers effectively quantify ADRB1 expression levels in different canine tissues?

Quantifying ADRB1 expression across canine tissues requires a multi-methodological approach for comprehensive analysis. The most established method involves using ELISA kits specifically designed for canine ADRB1, which offer high sensitivity and specificity for detecting ADRB1 levels in serum, plasma, tissue homogenates, and cell culture supernatants . For tissue-specific expression analysis, researchers should employ immunohistochemistry with specific antibodies against canine ADRB1, similar to the approach used for human samples . Quantitative PCR (qPCR) represents another valuable technique for measuring mRNA expression levels across tissues. When conducting these analyses, researchers should be mindful of physiological variables that might affect ADRB1 expression, including age, breed, health status, and environmental factors. For precise spatial localization, immunofluorescence microscopy techniques can reveal subcellular distribution patterns, confirming the expected cell membrane localization as a multi-pass membrane protein .

What approaches can be used to create functional recombinant dog ADRB1 for in vitro studies?

Creating functional recombinant dog ADRB1 for in vitro studies requires careful consideration of expression systems and protein engineering strategies. The most effective approach typically involves cloning the full canine ADRB1 coding sequence into mammalian expression vectors, ideally with epitope tags for detection and purification. For optimal functional expression, HEK293 or CHO cell lines are preferred expression systems as they provide appropriate post-translational modifications and membrane trafficking machinery. Critical methodological considerations include ensuring proper membrane integration and orientation, which can be verified using flow cytometry with antibodies against extracellular epitopes. Researchers must also validate the functionality of expressed receptors through ligand binding assays testing affinity for epinephrine and norepinephrine, which should bind with approximately equal affinity . Additionally, G protein coupling can be assessed through cAMP accumulation assays following stimulation with agonists. For structural studies requiring larger protein quantities, insect cell expression systems might prove advantageous, though careful validation of function is essential when changing expression platforms.

What are the optimal conditions for studying ADRB1-mediated signaling in canine cardiomyocytes?

Studying ADRB1-mediated signaling in canine cardiomyocytes requires careful attention to both isolation procedures and experimental conditions. For primary canine cardiomyocyte isolation, researchers should use enzymatic digestion with collagenase II and protease XIV under controlled calcium conditions to preserve cellular integrity and receptor functionality. Optimal culture conditions include supplementation with ascorbic acid to prevent catecholamine oxidation and minimize receptor desensitization. When conducting signaling experiments, time-course studies are essential as ADRB1 exhibits rapid desensitization following prolonged agonist exposure. For investigating specific ADRB1-mediated effects separately from beta-2 effects, selective antagonists like CGP 20712A (beta-1 selective) should be employed, while considering that canine cardiomyocytes express both receptor subtypes with different relative concentrations that determine the physiologic response . Measurement of downstream signaling should incorporate multiple endpoints including cAMP levels, PKA activity, calcium transients, and contractility parameters. Temperature control is particularly critical, as receptor kinetics and G-protein coupling efficiency are temperature-dependent, with 37°C being optimal for physiological relevance.

How can researchers distinguish between beta-1 and beta-2 adrenergic receptor signaling in canine cardiovascular studies?

Distinguishing between beta-1 and beta-2 adrenergic receptor signaling in canine cardiovascular studies requires a strategic combination of pharmacological, genetic, and biochemical approaches. Pharmacologically, researchers should employ subtype-selective agonists (e.g., dobutamine for beta-1, salbutamol for beta-2) and antagonists (e.g., CGP 20712A for beta-1, ICI 118,551 for beta-2) at carefully titrated concentrations. When interpreting results, it's essential to consider that tissues contain varying proportions of beta-1 and beta-2 receptors, with cardiac muscle containing predominantly beta-1 and skeletal muscle containing a mixture of both subtypes . For genetic approaches, siRNA knockdown or CRISPR-Cas9 editing can selectively reduce expression of individual receptor subtypes. At the molecular level, researchers can track specific downstream signaling events: while both receptors activate adenylate cyclase through Gs proteins, beta-2 receptors additionally couple to Gi proteins and activate MAP kinase pathways. When designing experiments, time-course analyses are crucial as beta-1 and beta-2 receptors exhibit different desensitization kinetics. For definitive receptor identification in tissue samples, immunoprecipitation with subtype-specific antibodies followed by Western blotting provides clear differentiation between these closely related receptor proteins.

What are the most reliable detection methods for canine ADRB1 in tissue samples?

Detection of canine ADRB1 in tissue samples can be accomplished through several complementary techniques, each with specific advantages. ELISA represents a highly quantitative method for ADRB1 detection, with commercially available kits offering specificity for natural and recombinant dog beta-1 adrenergic receptor . For spatial localization, immunohistochemistry (IHC-P) using validated antibodies provides visualization of receptor distribution across tissue sections . Western blotting with antibodies targeting conserved regions can quantify total receptor protein levels, though careful validation is necessary as antibodies may cross-react with beta-2 receptors due to structural similarity. For mRNA detection, RT-qPCR using primers specific to unique regions of canine ADRB1 offers high sensitivity and specificity. When performing these techniques, researchers should include appropriate controls: positive controls (tissues known to express high ADRB1 levels such as ventricular myocardium), negative controls (tissues with minimal expression), and competition assays to confirm antibody specificity. For most comprehensive analysis, researchers should combine protein-level detection methods with mRNA quantification to account for potential post-transcriptional regulation affecting receptor expression.

Detection MethodSample TypeAdvantagesLimitationsTechnical Considerations
ELISASerum, plasma, tissue homogenates, cell culture supernatantsHighly quantitative, commercially available kitsLimited spatial informationSample processing affects detection sensitivity
ImmunohistochemistryFixed tissue sectionsProvides spatial localizationSemi-quantitativeAntibody validation critical
Western BlottingTissue/cell lysatesConfirms molecular weight, quantitativeRequires tissue disruptionMembrane preparation methods affect yield
RT-qPCRTissue samples, cellsHigh sensitivity for mRNA detectionDoesn't confirm protein expressionPrimer design crucial for specificity
Radioligand BindingMembrane preparationsDirect measurement of functional receptorsTechnically demandingRequires radioactive materials handling

How does canine ADRB1 response to beta-blockers differ from human responses?

Canine ADRB1 responses to beta-blockers exhibit notable differences from human responses, with significant implications for comparative pharmacology and veterinary medicine. In humans, genetic variability in the ADRB1 gene is associated with variable therapeutic responses to beta-adrenergic receptor antagonists . Similarly, dogs exhibit genetic variations, particularly the two deletions identified in the cytoplasmic tail region of ADRB1 , which may influence drug responses. These structural differences likely contribute to species-specific pharmacokinetic and pharmacodynamic profiles. Methodologically, researchers investigating these differences should conduct comparative binding studies using the same beta-blockers across species, measuring parameters like binding affinity (Kd), receptor occupancy, and downstream signaling inhibition. Clinically, these differences manifest in varied dosing requirements and potentially different side effect profiles between species. Additionally, veterinary clinicians should consider that the beneficial effects observed with beta-blockers in human cardiac patients may not directly translate to canine patients due to these molecular differences, necessitating specific clinical trials in dogs rather than extrapolation from human medicine.

What role does ADRB1 play in canine heart failure models and how can it be targeted therapeutically?

ADRB1 plays a central role in canine heart failure pathophysiology and represents a key therapeutic target. In heart failure, chronic sympathetic activation leads to altered ADRB1 signaling, including receptor desensitization and downregulation, contributing to progressive cardiac dysfunction. Similar to humans, beta-adrenergic receptor antagonists are utilized for the management of several cardiac diseases in dogs , though their efficacy may be influenced by the genetic variations in the canine ADRB1 gene. When studying ADRB1 in canine heart failure models, researchers should quantify both receptor density and functionality, as heart failure often reduces receptor numbers while altering remaining receptor signaling efficiency. Therapeutic approaches should consider the potential for differential responses based on the specific genetic variants present in different dog breeds. Experimentally, pressure-overload or pacing-induced heart failure models in dogs can be particularly valuable for studying progressive ADRB1 changes and testing targeted therapies. Researchers should evaluate not only direct receptor antagonism but also interventions targeting downstream pathways or receptor desensitization mechanisms, potentially through GRK (G protein-coupled receptor kinase) inhibition strategies. Long-term studies are essential as receptor adaptations occur progressively over the disease course.

How can recombinant dog ADRB1 be used to screen for novel cardiovascular therapeutics?

Recombinant dog ADRB1 provides a valuable platform for screening novel cardiovascular therapeutics with several methodological advantages. Cell-based screening systems expressing recombinant canine ADRB1 enable high-throughput evaluation of compound libraries for receptor binding and functional effects. For optimal screening design, researchers should establish stable cell lines expressing physiologically relevant levels of canine ADRB1, validated through radioligand binding assays. Multiple readout systems should be incorporated, including immediate (cAMP accumulation, calcium flux) and downstream (PKA substrate phosphorylation) signaling events. Biased signaling assessment is particularly important, as compounds may preferentially activate certain pathways while inhibiting others. Comparison screens with human ADRB1 can identify species-specific compound interactions, critical for translational research. Additionally, researchers should consider the two identified deletions within the cytoplasmic tail region of canine ADRB1 , potentially creating variant receptor constructs to assess how these genetic differences affect drug responses. Advanced screening approaches may incorporate engineered cardiomyocytes derived from induced pluripotent stem cells expressing the recombinant dog ADRB1, providing a more physiologically relevant context for compound evaluation than heterologous expression systems.

How can researchers effectively study the interaction between ADRB1 and its partner proteins (GOPC, MAGI3, DLG4) in canine cardiac tissue?

Studying ADRB1 interactions with partner proteins in canine cardiac tissue requires sophisticated protein-protein interaction methodologies. Co-immunoprecipitation represents the foundation approach, using antibodies against either ADRB1 or its partners (GOPC, MAGI3, DLG4) followed by Western blotting to confirm interactions. For spatial visualization, proximity ligation assays (PLA) can detect protein interactions with subcellular resolution in fixed tissue sections. More quantitative assessment can be achieved through fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) between tagged proteins, though these typically require recombinant expression systems. Researchers should consider that these interactions may be dynamically regulated by receptor activation state, necessitating studies under both basal and stimulated conditions. Domain mapping experiments using truncated receptor constructs can identify specific interaction regions, particularly focusing on the cytoplasmic tail where canine-specific deletions have been identified . For functional relevance assessment, researchers should evaluate how disrupting these interactions affects receptor trafficking, signaling, and desensitization. Additionally, comparative studies between dog breeds with different ADRB1 variants may reveal how genetic differences in the cytoplasmic tail affect these protein interactions and downstream signaling consequences.

What approaches can determine if the identified deletions in canine ADRB1 cytoplasmic tail affect receptor desensitization?

Investigating how the identified deletions in the canine ADRB1 cytoplasmic tail affect receptor desensitization requires systematic experimental approaches focusing on receptor regulation dynamics. Researchers should first create expression constructs for both wild-type and deletion variant canine ADRB1, transfected into appropriate cell models. Desensitization kinetics can be measured through time-course stimulation experiments, monitoring cAMP accumulation following repeated or continuous agonist exposure. G protein-coupled receptor kinase (GRK) recruitment and beta-arrestin binding should be quantified, as these are key mechanisms of receptor desensitization. Receptor phosphorylation state can be assessed using phospho-specific antibodies or mass spectrometry approaches. Receptor internalization kinetics following agonist stimulation can be tracked using cell surface biotinylation or fluorescently tagged receptors with live-cell imaging. The deletions in the cytoplasmic tail region may affect receptor downregulation , so researchers should also measure receptor recycling rates and degradation pathways. Comparative studies across multiple dog breeds with different genetic variants would provide valuable insights into breed-specific cardiovascular responses. Additionally, computational molecular dynamics simulations comparing wild-type and variant receptors can predict structural impacts of these deletions on protein-protein interaction surfaces and conformational dynamics.

How does the involvement of ADRB1 in sleep/wake behavior regulation interact with its cardiovascular functions in canine models?

The dual involvement of ADRB1 in both sleep/wake behavior regulation and cardiovascular function represents a complex research area requiring integrative physiological approaches. ADRB1 has been implicated in the regulation of sleep/wake behaviors , while simultaneously playing a crucial role in cardiovascular control . Researchers investigating this interaction should employ continuous telemetric monitoring of both cardiovascular parameters (heart rate, blood pressure) and sleep/wake states (EEG/EMG recordings) in canine models. Correlation analyses between sleep architecture and cardiovascular variability can reveal how these systems interact under normal conditions. Selective pharmacological manipulation using beta-1 specific agonists and antagonists administered at different times of the sleep/wake cycle can delineate the directional relationships between these systems. Central versus peripheral ADRB1 functions should be distinguished using compounds with varying blood-brain barrier permeability. Particular attention should be given to REM sleep periods, which feature natural sympathetic activation patterns. Researchers should also consider breed differences, as the identified genetic variations in canine ADRB1 might contribute to breed-specific sleep patterns and cardiovascular profiles. Long-term studies examining how chronic cardiovascular conditions affect sleep patterns, and conversely how sleep disruption impacts cardiovascular health, would provide valuable insights into the integrative physiology of these interconnected regulatory systems.

What emerging technologies show promise for advancing canine ADRB1 research?

Several cutting-edge technologies are poised to revolutionize canine ADRB1 research in the coming years. CRISPR-Cas9 gene editing offers unprecedented opportunities to create precise genetic models incorporating the identified deletions in the cytoplasmic tail of canine ADRB1 , enabling detailed functional studies. Cryo-electron microscopy can now achieve near-atomic resolution of membrane proteins, potentially revealing the structural consequences of these genetic variations. Single-cell transcriptomics and proteomics approaches allow for cell-specific analysis of ADRB1 expression and signaling across heterogeneous cardiac tissues. Organ-on-chip technologies incorporating canine cardiomyocytes could provide physiologically relevant platforms for drug screening while reducing animal testing. Advanced optical techniques like optogenetics and genetically encoded biosensors enable precise temporal control and visualization of ADRB1 signaling dynamics in living cells. AI-driven computational approaches show promise for predicting ligand-receptor interactions and identifying novel binding sites on canine ADRB1. These technological advances should be applied to address fundamental questions about breed-specific ADRB1 variations and their functional consequences, potentially leading to more personalized approaches to canine cardiovascular medicine similar to human precision medicine initiatives.

How can comparative studies between human and canine ADRB1 advance therapeutic development?

Comparative studies between human and canine ADRB1 offer significant opportunities for therapeutic advancement in both species. By systematically characterizing structural and functional differences between human and canine ADRB1, researchers can identify conserved regions as targets for broad-spectrum therapeutics while recognizing species-specific domains requiring tailored approaches. Dogs represent valuable translational models for human cardiovascular diseases, but the identified genetic variations in canine ADRB1 must be considered when extrapolating drug responses between species. Methodologically, parallel screening of compound libraries against both human and canine ADRB1 can identify species-selective compounds while revealing shared pharmacophores. Binding site mapping through mutagenesis and computational modeling can pinpoint critical residues determining species-specific drug interactions. The cytoplasmic tail region, where deletions have been identified in canine ADRB1 , deserves particular attention as it may influence receptor regulation and drug response characteristics. Additionally, comparative studies of receptor-protein interactions, particularly with GOPC, MAGI3, and DLG4 , can reveal conserved signaling networks suitable for therapeutic targeting. Through these approaches, researchers can develop more predictive preclinical models and potentially identify novel therapeutic strategies beneficial for both veterinary and human medicine, particularly for cardiovascular conditions where beta-adrenergic signaling plays a central role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.