Recombinant Dog C-C chemokine receptor type 3 (CCR3)

Shipped with Ice Packs
In Stock

Description

Biological Function

CCR3 binds chemokines such as eotaxin (CCL11), RANTES (CCL5), and MCP-4 (CCL13), facilitating immune cell chemotaxis. In dogs, CCR3 is primarily expressed on eosinophils, basophils, and Th2 cells, where it mediates allergic inflammation and responses to parasitic infections .

Key Functional Roles

  • Immune Cell Recruitment: Drives eosinophil migration to sites of inflammation .

  • Allergic Response Regulation: Linked to allergic airway diseases and atopic dermatitis in canine models .

  • Viral Entry: Acts as a co-receptor for certain viral pathogens (e.g., HIV-1 in humans; relevance in dogs under investigation) .

Research Applications

Recombinant Dog CCR3 is widely used in:

  • Drug Discovery: Screening for antagonists to treat allergic diseases .

  • Mechanistic Studies: Investigating eosinophil activation in asthma and parasitic infections .

  • Diagnostic Development: Serving as a biomarker for basophil activation in chronic urticaria .

Case Study: Basophil Activation (Khanolkar et al., 2013)

  • Objective: Assess CCR3 stability on basophils during chronic urticaria (CU) .

  • Methods: Donor basophils were treated with IgE-Fc receptor agonistic antibodies and CU-patient sera.

  • Findings:

    • CCR3 expression decreased significantly on activated basophils (P < 0.05) .

    • Downregulation correlated with histamine release, suggesting CCR3 as a surrogate activation marker .

Comparative Insights Across Species

While dog CCR3 shares 68–70% amino acid identity with human and rodent variants , species-specific differences exist:

FeatureDog CCR3Human CCR3
Amino Acid Length359355
Key LigandsEotaxin, RANTES, MCP-4Eotaxin, RANTES, MCP-3
Expression PatternHigh in eosinophils, airway epitheliumSimilar, with added roles in HIV entry

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade the protein; single-use aliquots are recommended .

  • Therapeutic Potential: CCR3 antagonists could treat canine allergic dermatitis or asthma, though in vivo studies remain limited .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference when placing the order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is defined during production. If you require a specific tag type, please inform us, and we will prioritize its development accordingly.
Synonyms
CCR3; CMKBR3; C-C chemokine receptor type 3; C-C CKR-3; CC-CKR-3; CCR-3; CCR3; CKR3; CD antigen CD193
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-359
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MEATTAEIKTMDESIQTTVFDYENSLPCEKVNIKHLGAQFLPPLYSLVFVIGLLGNVVVV VILTKYKRLWIMTNIFLLNLAISDLLFLFTLVFWIHYTGWNDWVFGRSMCKLISGLYYLG LYGEIFFIILLTIDRYLAIVHAVFALRARTVTFGIITSVLTWGLAGLAALPEFIFHESQK ESEQFVCTPLYPKDQEDNWKRFHALRMNILGLALPLLIMVVCYSGIIKTLLRCPSKKKYK AIRLIFVIMVVFFIFWTPYNLVLLLSAFQTIFFETTCEQSKQLDVAMQITEVIAYTHCCI NPIIYAFVGERFRKHLCHFFRRNVATYLGKYIPFLPSEKLERSSSVSPSTGEQEFSFVF
Uniprot No.

Target Background

Function
Recombinant Dog C-C chemokine receptor type 3 (CCR3) is a receptor for C-C type chemokines. It binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5), and CCL15. Upon binding, CCR3 transduces a signal by increasing intracellular calcium ion levels. Additionally, it may function as a receptor for NARS1.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is canine CCR3 and how does it function within the immune system?

Canine CCR3 (C-C motif chemokine receptor 3) is a G protein-coupled receptor belonging to family 1 of GPCRs. It functions primarily as a receptor for C-C type chemokines in dogs. Like its human counterpart, canine CCR3 plays a critical role in inflammatory and immune responses by mediating the chemotaxis of specific immune cells. The protein is highly expressed in eosinophils and basophils, and can also be detected in TH1 and TH2 cells, as well as airway epithelial cells .

Functionally, canine CCR3 responds to multiple chemokines, including eotaxin (CCL11), eotaxin-3 (CCL26), MCP-3 (CCL7), MCP-4 (CCL13), and RANTES (CCL5). When these ligands bind to CCR3, they trigger intracellular signaling cascades that ultimately result in cell migration and activation. This receptor contributes significantly to the accumulation and activation of eosinophils and other inflammatory cells in allergic conditions affecting the respiratory system and skin of dogs .

How does canine CCR3 structure compare to human CCR3?

Canine CCR3 shares substantial homology with human CCR3, though specific amino acid differences exist that may affect ligand binding affinity and signaling properties. The protein consists of approximately 355 amino acids with a molecular weight of around 41 kDa . Like human CCR3, the canine variant features the characteristic seven-transmembrane domain structure typical of G protein-coupled receptors.

The extracellular domains of canine CCR3 are responsible for chemokine recognition and binding, while the intracellular domains mediate signal transduction through G-protein activation. These structural features are conserved across species, though species-specific variations in the binding pocket may influence the receptor's pharmacological properties and its interaction with both natural ligands and synthetic compounds designed for research or therapeutic purposes.

What expression systems are most effective for producing recombinant canine CCR3?

Based on current methodologies in recombinant protein production, several expression systems have proven effective for canine CCR3:

  • Mammalian Expression Systems: HEK293T cells represent one of the most effective systems for producing recombinant canine CCR3, as they provide appropriate post-translational modifications and proper protein folding essential for receptor functionality . This system is particularly valuable when the goal is to produce CCR3 protein that closely resembles its native conformation.

  • Fusion Protein Approaches: For enhanced stability and purification, expressing canine CCR3 as a fusion protein with tags such as the Fc region of canine IgG-B has proven beneficial. This approach can increase protein half-life and maintain proper blood concentration for long-term experimental effects .

The expression vector selection is crucial, with pcDNA3.1(+) being a common choice for mammalian expression. Codon optimization of the coding sequence for the expression system is recommended to maximize protein production levels .

What are the critical considerations when designing recombinant canine CCR3 constructs?

When designing recombinant canine CCR3 constructs, researchers should consider:

  • Domain Selection: Carefully determining which domains of canine CCR3 to include based on the intended application. For ligand binding studies, the extracellular domains are critical.

  • Fusion Partners: Selection of appropriate fusion partners can dramatically affect expression levels, solubility, and functionality. For instance:

    • His-tags (HHHHHH) facilitate purification via metal affinity chromatography

    • Fc-fusion (canine IgG-B Fc region) enhances stability and half-life

    • Flag-tags (DYKDDDDK) enable detection in immunoassays

  • Signal Peptides: Inclusion of an efficient signal peptide (such as from interleukin-2) to ensure proper targeting to the secretory pathway and membrane insertion .

  • Restriction Sites: Strategic placement of restriction sites (such as HindIII and EcoRI) to facilitate cloning and subsequent manipulations .

  • Codon Optimization: Adapting the coding sequence to the codon usage bias of the expression host to enhance translation efficiency .

How can researchers verify the functional activity of recombinant canine CCR3?

Verifying functional activity of recombinant canine CCR3 requires multiple complementary approaches:

  • Binding Assays:

    • Competitive binding assays using labeled natural ligands (CCL11, CCL26, etc.)

    • Surface plasmon resonance (SPR) to determine binding kinetics

    • ELISA-based binding assays with recombinant ligands

  • Signaling Assays:

    • Measuring intracellular calcium mobilization following ligand binding

    • Assessing phosphorylation of downstream signaling molecules in the MAPK-P38-ERK pathway

    • Monitoring activation of the Gq-PLC-Ca2+ signaling cascade

  • Functional Cell-Based Assays:

    • Chemotaxis assays to evaluate CCR3-mediated cell migration

    • Degranulation assays with basophils or mast cells expressing recombinant canine CCR3

    • Receptor internalization studies following ligand exposure

The functionality can be compared to positive controls such as native canine CCR3 expressed on primary canine eosinophils or basophils to establish relative activity levels.

What signaling pathways are activated by canine CCR3 and how can they be studied?

Canine CCR3 activates several key signaling pathways that can be studied using various techniques:

  • Gq-PLC-Ca2+ Pathway:

    • Upon ligand binding, CCR3 activates Gq proteins, leading to phospholipase C (PLC) activation

    • This results in inositol triphosphate (IP3) generation and calcium mobilization

    • Can be measured using calcium-sensitive fluorescent dyes and flow cytometry or plate readers

  • MAPK-P38-ERK Pathway:

    • CCR3 activation triggers the mitogen-activated protein kinase (MAPK) cascade

    • This involves phosphorylation of p38 and ERK

    • Can be assessed via Western blotting using phospho-specific antibodies

  • β-Arrestin Recruitment:

    • Following activation, CCR3 recruits β-arrestin, leading to receptor desensitization and internalization

    • Can be studied using bioluminescence resonance energy transfer (BRET) assays

These pathways are essential for CCR3-mediated functions, including chemotaxis, degranulation, and inflammatory mediator release in canine immune cells.

How can recombinant canine CCR3 be utilized to study allergic conditions in dogs?

Recombinant canine CCR3 provides valuable tools for studying allergic conditions in dogs through several applications:

  • Ligand Screening: Recombinant CCR3 can be used to screen for novel ligands or antagonists with potential therapeutic value in canine allergic diseases.

  • Ex Vivo Studies: By comparing CCR3 expression and function in samples from healthy dogs versus those with allergic conditions, researchers can identify disease-specific alterations.

  • Blocking Studies: Recombinant CCR3-Fc fusion proteins can act as decoy receptors, binding chemokines and preventing their interaction with cell-surface CCR3, similar to the approach used with other receptor-Fc fusion proteins . This strategy allows evaluation of CCR3 pathway inhibition in allergic responses.

  • Biomarker Development: Quantification of soluble CCR3 or its ligands in biological fluids may serve as biomarkers for disease progression or treatment response in canine allergic conditions.

  • Comparative Studies: Recombinant canine CCR3 enables direct comparison with human CCR3, facilitating translational research and the development of interventions that might benefit both species.

What role does canine CCR3 play in eosinophil recruitment during allergic reactions?

Canine CCR3 serves as the primary chemokine receptor driving eosinophil recruitment during allergic reactions in dogs through several mechanisms:

  • Chemotaxis Induction: When eotaxin (CCL11) and other ligands bind to CCR3 on canine eosinophils, they trigger directional migration toward sites of allergen exposure and inflammation .

  • Adhesion Molecule Upregulation: CCR3 signaling enhances the expression of adhesion molecules on eosinophils, facilitating their attachment to endothelial cells and subsequent migration into tissues.

  • Survival Promotion: CCR3 activation extends eosinophil survival in tissues through anti-apoptotic signaling, prolonging their presence at sites of allergic inflammation.

  • Degranulation Enhancement: In addition to recruitment, CCR3 signaling primes eosinophils for enhanced degranulation responses, exacerbating tissue damage through the release of cytotoxic granule proteins.

  • Cross-talk with Other Immune Cells: Eosinophils recruited via CCR3 interact with mast cells, basophils, and T cells, amplifying the allergic cascade through cytokine production and cellular activation.

This central role of CCR3 in eosinophil trafficking makes it a promising target for therapeutic intervention in canine allergic conditions characterized by eosinophilic inflammation.

What techniques are recommended for studying canine CCR3 expression patterns across different tissues?

Several complementary techniques provide comprehensive analysis of canine CCR3 expression patterns:

  • RNA-Seq Analysis: High-throughput RNA sequencing offers a powerful approach to quantify CCR3, as demonstrated in studies characterizing T-cell receptor repertoires in canine tissues . This technique provides information on transcript levels across diverse tissue samples.

  • Quantitative RT-PCR: For targeted analysis, qRT-PCR with CCR3-specific primers allows precise quantification of mRNA expression across different tissues, cell types, and disease states.

  • Flow Cytometry: Multiparameter flow cytometry using anti-CCR3 antibodies enables identification and quantification of CCR3+ cells within complex cell populations, including determination of expression levels on a per-cell basis.

  • Immunohistochemistry (IHC): IHC analysis of tissue sections using validated anti-CCR3 antibodies allows visualization of CCR3+ cells within their tissue microenvironment, providing spatial context to expression patterns.

  • Single-Cell RNA-Seq: This technique provides unprecedented resolution of CCR3 expression at the single-cell level, revealing heterogeneity within cell populations that may be masked in bulk analyses.

These approaches can reveal tissue-specific expression patterns of canine CCR3, with known high expression in eosinophils, basophils, and certain T-cell subsets, along with expression in airway epithelial cells that may vary in health and disease .

How can researchers develop effective CCR3 antagonists for canine allergic conditions?

Development of effective CCR3 antagonists for canine allergic conditions involves a systematic approach:

  • Structure-Based Design: Using homology models of canine CCR3 based on crystallographic structures of related GPCRs to identify potential binding pockets for small molecule antagonists.

  • High-Throughput Screening:

    • Cell-based assays using HEK293T cells expressing recombinant canine CCR3

    • Calcium mobilization assays to identify compounds that block signaling

    • Chemotaxis inhibition assays to assess functional antagonism

  • Receptor-Fc Decoy Approach: Following methodologies similar to those used for other recombinant receptor-Fc proteins :

    • Construction of canine CCR3 extracellular domain fused to canine IgG-B Fc region

    • Expression in HEK293T cells with optimized culture conditions

    • Purification using protein A/G affinity chromatography

    • Validation of binding to CCR3 ligands using techniques such as ELISA or SPR

  • In Vitro Validation:

    • Demonstration of antagonist binding to recombinant canine CCR3

    • Confirmation of blocked signaling through calcium flux inhibition

    • Verification of inhibited chemotaxis in canine eosinophils or basophils

    • Assessment of specificity through counter-screening against related chemokine receptors

  • Ex Vivo Testing:

    • Evaluation using blood samples or tissue explants from dogs with allergic conditions

    • Measurement of inhibition of eosinophil activation and degranulation

This systematic approach can identify potent and selective antagonists of canine CCR3 with potential therapeutic applications in allergic diseases.

What are common challenges in producing functional recombinant canine CCR3 and how can they be addressed?

Researchers face several challenges when producing functional recombinant canine CCR3:

  • Low Expression Levels:

    • Challenge: GPCRs like CCR3 often express poorly in recombinant systems

    • Solution: Use strong promoters (CMV), optimize codon usage for the expression host, and consider fusion partners that enhance expression (such as Fc)

  • Protein Misfolding:

    • Challenge: Transmembrane proteins frequently misfold when overexpressed

    • Solution: Express in mammalian cells (HEK293T) rather than bacterial systems, optimize growth temperature (30-32°C), and include chemical chaperones in the culture medium

  • Aggregation During Purification:

    • Challenge: CCR3 may aggregate when extracted from membranes

    • Solution: Use mild detergents (DDM, LMNG), include stabilizing agents, and consider purifying as a fusion protein with stabilizing partners like Fc

  • Loss of Functionality:

    • Challenge: Purified CCR3 may lose ligand-binding capacity

    • Solution: Verify functionality at each purification step, use ligand affinity chromatography to select functional protein, and stabilize with lipid nanodiscs or similar membrane mimetics

  • Glycosylation Heterogeneity:

    • Challenge: Variable glycosylation can affect function and complicate analysis

    • Solution: Use glycosylation site mutants or enzymatic deglycosylation to produce homogeneous preparations, or employ cell lines with simplified glycosylation patterns

Addressing these challenges through careful optimization of expression systems, purification conditions, and functionality assays is essential for obtaining high-quality recombinant canine CCR3 for research applications.

How can researchers troubleshoot inconsistent results in CCR3 binding assays?

When facing inconsistent results in CCR3 binding assays, researchers should systematically troubleshoot:

  • Protein Quality Issues:

    • Verify recombinant CCR3 integrity by SDS-PAGE and Western blotting

    • Assess glycosylation status through glycosidase treatments and mobility shift assays

    • Check for proteolytic degradation and add appropriate protease inhibitors

  • Ligand Considerations:

    • Confirm ligand quality and activity through parallel assays with known positive controls

    • Consider batch-to-batch variation in commercial chemokines

    • Verify correct storage conditions to prevent ligand degradation

  • Binding Assay Parameters:

    • Optimize buffer composition (pH, ionic strength, divalent cations)

    • Titrate detergent concentrations when working with membrane preparations

    • Control temperature precisely during binding reactions

    • Evaluate non-specific binding and include appropriate controls

  • Technical Considerations:

    • Standardize washing procedures in solid-phase assays

    • Calibrate equipment regularly (e.g., plate readers, flow cytometers)

    • Use internal standards across experiments to normalize results

  • Data Analysis Approaches:

    • Apply appropriate mathematical models for binding data

    • Consider one-site versus two-site binding models

    • Use statistical methods to identify outliers

By systematically addressing these potential sources of variability, researchers can significantly improve the consistency and reliability of canine CCR3 binding assay results.

How might single-cell technologies advance our understanding of canine CCR3 biology?

Single-cell technologies offer transformative potential for advancing canine CCR3 research:

  • Single-Cell RNA Sequencing (scRNA-seq):

    • Reveals heterogeneity in CCR3 expression within canonically positive cell populations

    • Identifies previously unrecognized CCR3-expressing cell types

    • Maps co-expression patterns with other receptors and mediators

    • Similar approaches have already yielded insights in canine T-cell receptor studies

  • Single-Cell Proteomics:

    • Quantifies CCR3 protein levels in individual cells

    • Correlates CCR3 expression with activation state markers

    • Measures phosphorylation states of downstream signaling molecules

  • Single-Cell ATAC-Seq:

    • Maps chromatin accessibility at the CCR3 locus in different cell types

    • Identifies cell-specific regulatory elements controlling CCR3 expression

    • Reveals epigenetic changes associated with allergic sensitization

  • Spatial Transcriptomics:

    • Localizes CCR3-expressing cells within tissue microenvironments

    • Identifies spatial relationships with other immune cells and structural cells

    • Maps chemokine gradients in relation to CCR3+ cell positioning

  • Integrated Multi-Omics Analysis:

    • Combines transcriptomic, proteomic, and functional data at single-cell resolution

    • Builds computational models of CCR3 regulation and function

    • Identifies novel therapeutic targets within the CCR3 signaling network

These technologies will enable unprecedented dissection of canine CCR3 biology, revealing functional heterogeneity among CCR3-expressing cells and identifying novel regulatory mechanisms that may be targeted therapeutically.

What are promising approaches for targeting canine CCR3 in allergic diseases?

Several innovative approaches show promise for targeting canine CCR3 in allergic diseases:

  • Receptor-Fc Fusion Proteins:

    • Engineered soluble CCR3-Fc fusion proteins that act as decoy receptors

    • Capture CCR3 ligands before they can engage cell-surface receptors

    • Similar approach has proven effective for other receptor systems

    • Potentially long half-life due to Fc region stabilization

  • Small Molecule Antagonists:

    • Structure-based design of compounds that block CCR3-chemokine interaction

    • Allosteric modulators that alter receptor conformation and signaling

    • Biased antagonists that selectively inhibit pro-inflammatory signaling pathways

  • Therapeutic Antibodies:

    • Humanized or caninized anti-CCR3 monoclonal antibodies

    • Blocks ligand binding and may induce receptor internalization

    • Potential for antibody-dependent cellular cytotoxicity against CCR3+ cells

  • RNA Therapeutics:

    • siRNA or antisense oligonucleotides targeting CCR3 mRNA

    • Local delivery to affected tissues (e.g., airways, skin)

    • May achieve tissue-specific knockdown with reduced systemic effects

  • Gene Editing Approaches:

    • Ex vivo CRISPR-Cas9 modification of CCR3 in adoptively transferred cells

    • Engineering of regulatory T cells to suppress CCR3-dependent inflammation

    • Modification of CCR3 promoter activity in targeted cell populations

Each approach offers distinct advantages and challenges, with receptor-Fc fusion proteins representing a promising near-term strategy given successful precedents with other receptor systems in both human and veterinary medicine .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.