Recombinant Dog C-C chemokine receptor type 4 (CCR4)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dog C-C Chemokine Receptor Type 4 (CCR4)

Recombinant Dog CCR4 is a genetically engineered protein derived from the canine C-C chemokine receptor type 4, a G protein-coupled receptor (GPCR) critical for immune cell chemotaxis and tumor microenvironment modulation. This receptor, also known as CD194, binds chemokines such as CCL17, CCL22, and CCL2, directing regulatory T cells (Tregs) and other lymphocytes to inflammation sites or tumors . Its recombinant form is utilized in research to study canine immune responses, cancer biology, and therapeutic interventions.

Production and Functional Validation of Recombinant Dog CCR4

Recombinant Dog CCR4 is synthesized using heterologous expression systems, including wheat germ or viral-like particles (VLPs) . Functional validation involves:

Binding Assays

  • ELISA: Immobilized canine CCR4 binds anti-CCR4 antibodies (e.g., EC₅₀ = 2.8–3.4 ng/mL for full-length protein) .

  • SPR Assay: Affinity constant (Kd) of 3.16 nM for antibody binding .

  • Chemotaxis: Canine Tregs migrate toward CCL2 or glioma-derived supernatant, blocked by CCR4 antagonists (e.g., C-021) .

Assay TypeKey FindingsSource
ELISAEC₅₀ of 2.8–3.4 ng/mL for full-length CCR4 binding to anti-CCR4 antibody .
SPRHigh-affinity binding (Kd = 3.16 nM) to monoclonal antibodies .
ChemotaxisCCL2-induced Treg migration abolished by CCR4 blockade .

Cancer Immunology

  • Treg Recruitment: CCR4 mediates Treg infiltration into gliomas and bladder cancers, enhancing tumor immunosuppression .

  • Therapeutic Blockade: Anti-CCR4 antibodies (e.g., mogamulizumab) deplete Tregs, slowing tumor growth in canine xenograft models .

Mechanistic Studies

  • CCL2-CCR4 Axis: Glioma cells upregulate CCL2 mRNA in response to Tregs, driving Treg migration via CCR4 .

  • Cross-Species Reactivity: Human anti-CCR4 antibodies (e.g., mogamulizumab) inhibit canine CCR4 function, enabling translational research .

Comparative Analysis: Canine vs. Human CCR4

FeatureCanine CCR4Human CCR4
Ligand SpecificityBinds CCL2, CCL17, CCL22 .Binds CCL17, CCL22, CKLF1 .
Treg RoleCritical for glioma/bladder cancer Treg recruitment .Promotes Treg homing in autoimmune diseases and cancers .
Therapeutic TargetValidated in canine glioma/bladder cancer models .Targeted in CTCL and autoimmune diseases (e.g., mogamulizumab) .

Therapeutic Potential and Future Directions

  • CCR4 Blockade: Small-molecule antagonists (e.g., C-021, AZD2098) and monoclonal antibodies (e.g., mogamulizumab) show efficacy in preclinical canine models .

  • T Cell Engineering: Transducing cytotoxic T cells with CCR4 could enhance tumor infiltration, as shown in murine pancreatic cancer models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
CCR4; C-C chemokine receptor type 4; C-C CKR-4; CC-CKR-4; CCR-4; CCR4; CD antigen CD194
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-360
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MNPTDIADTTLDESIYNNYYLYENIPKPCTKEGIKAFGELFLPPLYSLVFLFGLLGNSVV VVVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIISWMYLVG FYSGIFFIMLMSIDRYLAIVHAVFSLRARTLTYGVITSLATWSVAVLASLPGLLFSTCYT ERNHTYCKTKYSRNSTRWKVLSSLEINILGLVIPLGTMLFCYSMIIRTLQHCKNEKKSKA VRMVFAVVALFLGFWAPYNVVLFLETLVELEVLQDCTFERHLDYAIQATETLAFVHCCLN PVIYFFLGEKFRKYLVQLFKTCRGPFMLCQYCRLLQMYSPDTPSSSYTQSTGDHDLHDAL
Uniprot No.

Target Background

Function
CCR4 (C-C chemokine receptor type 4) is a high-affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. Its activity is mediated by G(i) proteins, which activate a phosphatidylinositol-calcium second messenger system. CCR4 may play a role in lipopolysaccharide (LPS)-induced endotoxic shock. In the central nervous system (CNS), it could mediate hippocampal-neuron survival.
Database Links

KEGG: cfa:403541

STRING: 9615.ENSCAFP00000006935

UniGene: Cfa.56

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in thymus, spleen, heart, small intestine and lymph node.

Q&A

Basic Research Questions

  • What is canine CCR4 and what are its basic structural and functional characteristics?

CCR4 is a G protein-coupled seven transmembrane receptor that plays a crucial role in immune cell trafficking. In dogs, the CCR4 cDNA contains an open reading frame of 1083 nucleotides encoding 360 amino acids. The predicted amino acid sequence of canine CCR4 shows remarkable conservation with other species, displaying 91.9%, 85.3%, and 84.5% similarity with human, mouse, and guinea pig counterparts, respectively .

Functionally, CCR4 is selectively expressed on Th2 cells and is involved in their trafficking to inflammatory sites. The receptor is crucial for mediating chemotactic responses to its ligands, primarily CCL17 (thymus and activation-regulated chemokine or TARC) and CCL22 . Recent research has also identified CCL2 as an important ligand that can signal through CCR4 .

In healthy dogs, CCR4 is expressed in various tissues including thymus, spleen, heart, small intestine, and lymph nodes . Within peripheral blood, CCR4 is primarily expressed on regulatory T cells (Tregs), with normal dogs showing approximately 23.6±4.3% of CD4+ T cells expressing CCR4 .

  • How does CCR4 expression vary in different canine pathological conditions?

In canine atopic dermatitis (cAD), CCR4 shows significantly altered expression patterns compared to healthy dogs:

  • CCR4 mRNA is preferentially expressed in lesional skin of dogs with atopic dermatitis, alongside its ligand TARC (CCL17)

  • The proportion of CCR4+ cells in peripheral blood CD4+ cells (CCR4/CD4) in dogs with atopic dermatitis is significantly higher (40.3±3.3%) compared to normal dogs (23.6±4.3%; P<0.01)

  • In experimentally sensitized dogs (Japanese cedar pollen model), the proportion of CCR4/CD4 increases from 25.4±2.6% at pre-sensitization to 29.8±2.9% post-sensitization (P<0.01)

In canine cancer models, CCR4 expression has been documented in regulatory T cells infiltrating high-grade gliomas, where it plays a role in Treg trafficking to the tumor microenvironment . This suggests CCR4 may be an important mediator of immunosuppression in canine cancer models.

The expression data across different pathological conditions demonstrates CCR4's role as a biomarker for immune dysregulation and potential therapeutic target in canine disease models.

  • What are the standard methods for detecting CCR4 expression in canine samples?

Several methodological approaches have been validated for detecting CCR4 in canine samples:

mRNA Detection:

  • Quantitative real-time PCR (qRT-PCR) using canine-specific primers has been successfully used to measure CCR4 mRNA expression in tissues and isolated cells

Protein Detection:

  • Flow cytometry using anti-CCR4 antibodies for cell surface expression

  • Indirect detection using recombinant ligands (e.g., fusion proteins containing CCL19 or CCL22) that specifically bind to CCR4

  • Immunohistochemistry on tissue sections for localization studies

Functional Assays:

  • Chemotaxis assays to measure CCR4-dependent cell migration in response to chemokines

  • Calcium flux assays for receptor activation

When antibody availability is limited, researchers have successfully employed alternative approaches such as using fusion proteins of CCR4 ligands (like CCL19-hIgG-Fc) as an alternative to CCR4 antibodies for flow cytometry .

  • How do CCR4 ligands differ in their interaction with the receptor in canine models?

Canine CCR4 interacts with multiple ligands, each with distinct binding and signaling characteristics:

  • CCL17 (TARC): A primary ligand for CCR4 in dogs. Its expression is increased in lesional skin of dogs with atopic dermatitis . Serum CCL17 concentrations correlate with disease severity in canine atopic dermatitis, with concentrations significantly decreasing after successful treatment . This makes it a valuable biomarker for monitoring therapeutic responses.

  • CCL22: Another canonical ligand for CCR4. In canine research models, CCL22 is highly expressed by immune cells in pancreatic cancer, and engineered T cells expressing CCR4 show enhanced migration towards CCL22 gradients .

  • CCL2: Recent research has identified CCL2 as a non-canonical ligand for CCR4 in canine models. The CCL2-CCR4 interaction promotes regulatory T cell trafficking to tumors in canine high-grade glioma . Importantly, canine Treg migration is enhanced by CCL2 or by glioma cell line-derived supernatant, and this migration can be blocked by CCR4 antagonists .

Cross-reactivity studies indicate that canine CCR4 can respond to human recombinant CCL2, making it possible to use human recombinant proteins in canine experimental systems .

Advanced Research Questions

  • What are the optimal expression systems and purification strategies for producing functional recombinant canine CCR4?

Producing functional recombinant G protein-coupled receptors (GPCRs) like CCR4 presents significant technical challenges due to their membrane-embedded nature. Based on available research on chemokine receptors, the following strategies are recommended for canine CCR4:

Expression Systems:

Purification Strategies:

  • Affinity chromatography using epitope tags (His, FLAG) positioned at the N-terminus to avoid interference with C-terminal signaling domains

  • Size exclusion chromatography for final purification and buffer exchange

  • Use of detergents or lipid nanodiscs to maintain the native conformation during purification

Critical Considerations:

  • Inclusion of stabilizing agents (glycerol, specific lipids) in buffer systems

  • Temperature control during expression and purification

  • Validation of protein folding using conformationally-sensitive antibodies

  • Functional validation through ligand binding assays

For structural studies, techniques used successfully with human chemokine receptors, including stabilizing mutations and use of fusion proteins like T4 lysozyme, may be adaptable to canine CCR4 .

  • What experimental approaches are most effective for studying CCR4-dependent cell migration in canine models?

Several robust methodologies have been validated for studying CCR4-mediated migration in canine models:

In vitro Migration Assays:

  • Transwell Migration Assay: The most widely used method involves 5μm pore polycarbonate filter inserts in 24-well plates . Canine CCR4+ cells are placed in the upper chamber, while chemokines or cell-derived supernatants are placed in the lower chamber. After 6-hour incubation (37°C, 5% CO2), migrated cells in the bottom chamber are counted, excluding dead cells by trypan blue staining.

  • Time-lapse Microscopy: For real-time visualization of migration dynamics

Experimental Controls and Validations:

  • Use of CCR4 antagonists (e.g., C021 dihydrochloride at 5μM) to confirm receptor specificity

  • Anti-chemokine antibodies (e.g., anti-CCL2 at 5.0 μg/ml) to verify ligand specificity

  • Comparison between CCR4+ and CCR4- cell populations under identical conditions

Ex vivo and In vivo Approaches:

  • Adoptive transfer of labeled CCR4+ and CCR4- cells to track migration patterns

  • Genetic approaches using CCR4-transduced T cells compared to non-functional mutant CCR4 (CCR4del) to assess migration capacity in disease models

Data Analysis Parameters:

  • Migration index (number of cells migrating in test condition/number in control)

  • Percentage of input cells that migrate

  • Enrichment of CCR4+ cells in the migrated population compared to input

These methodologies have successfully demonstrated that canine Tregs show enhanced migration toward CCL2 and glioma cell line-derived supernatants, which can be blocked by CCR4 antagonists .

  • How can researchers design effective experimental controls when studying CCR4 function in canine disease models?

Robust experimental design for studying canine CCR4 requires carefully selected controls at multiple levels:

Cellular Controls:

  • Positive Cell Controls: Use cell populations known to express high levels of CCR4, such as CD4+CD25high T cells, which are enriched for FOXP3 and CCR4 expression in dogs .

  • Negative Cell Controls: Include CD4+CD25low populations or CD8+ T cells, which have lower CCR4 expression .

  • Receptor Expression Controls: Compare cells transduced with functional CCR4 versus non-functional mutant CCR4 (CCR4del) to establish receptor-specific effects .

Molecular and Pharmacological Controls:

  • Receptor Blocking: CCR4 antagonists such as C021 dihydrochloride (5μM) can confirm receptor specificity in migration assays .

  • Ligand Neutralization: Anti-chemokine antibodies (e.g., anti-CCL2 at 5.0 μg/ml) to verify chemokine specificity .

  • Genetic Controls:

    • Non-targeting siRNA for knockdown studies

    • Empty vector controls for overexpression studies

    • CRISPR-Cas9 with non-targeting gRNAs for knockout studies

Disease Model Validation:

  • Tissue Expression: Compare CCR4 expression between healthy and diseased tissues (e.g., normal skin vs. lesional skin in atopic dermatitis) .

  • Treatment Response: Monitor changes in CCR4+ cell populations before and after therapeutic intervention, as demonstrated in allergen sensitization models .

Experimental Design Table for CCR4 Function Studies:

Research QuestionPositive ControlsNegative ControlsValidation Methods
CCR4 expression in diseaseCD4+CD25high T cellsCD4+CD25low T cellsqRT-PCR, Flow cytometry
Ligand specificityKnown ligands (CCL17, CCL22)Unrelated chemokinesBinding assays, Chemotaxis
Migration capacityCCR4-transduced cells with ligandCCR4del-transduced cells with ligandTranswell migration assay
In vivo relevanceDisease model with documented CCR4 involvementHealthy control or CCR4 antagonist-treatedImmunohistochemistry, Flow cytometry of tissues
  • What is the current state of research on CCR4 antagonists in canine models and their potential therapeutic applications?

Research on CCR4 antagonists in canine models has shown promising results for several disease conditions:

Validated CCR4 Antagonists in Canine Studies:

  • C021 dihydrochloride: This small molecule CCR4 antagonist has been successfully used in canine research at a concentration of 5μM in in vitro studies .

  • Anti-CCR4 monoclonal antibodies: Have shown efficacy in canine cancer models, reducing Treg infiltration and improving survival time in dogs affected with bladder and prostate cancer .

Therapeutic Mechanisms and Effects:

  • Pain Management: In murine models applicable to canine research, CCR4 antagonist (C021) administration dose-dependently diminished neuropathic pain-related behaviors. The pharmacological blockade of CCR4 enhanced the analgesic properties of morphine and buprenorphine and delayed the development of morphine tolerance .

  • Cancer Immunotherapy: In canine high-grade glioma models, blocking the CCL2-CCR4 axis significantly reduced migration of canine Tregs to tumor sites . This represents a promising approach for reversing tumor-induced immunosuppression.

  • Allergic Diseases: Given the established role of CCR4 in canine atopic dermatitis and the correlation between CCR4+ cell numbers and disease severity , CCR4 antagonists represent a potential therapeutic target for allergic conditions in dogs.

Current Research Challenges:

  • Optimizing drug delivery to specific tissues

  • Development of canine-specific antagonists with improved pharmacokinetics

  • Determining optimal dosing regimens for different disease conditions

  • Assessing long-term safety profiles

Future Research Directions:

  • Combination approaches with existing therapies

  • Development of small molecule inhibitors with improved specificity and half-life

  • Exploration of alternative administration routes

  • Potential for CCR4-targeted cell therapies similar to recent advances in human oncology

  • How does CCR4 signaling in dogs compare to other species, and what are the implications for translational research?

Comparative analysis of CCR4 across species reveals both conserved and divergent features that impact translational research:

Structural Conservation:
The canine CCR4 protein shares high sequence homology with other mammalian species: 91.9% with human, 85.3% with mouse, and 84.5% with guinea pig . This structural conservation suggests fundamental signaling mechanisms are likely preserved across species.

Functional Similarities:

  • CCR4 serves as a receptor for CCL17 and CCL22 across species

  • Predominant expression on regulatory T cells and Th2 cells is consistent

  • Association with allergic diseases and immunoregulation in both humans and dogs

  • CCL2 can signal through CCR4 in both canine and human systems

Species-Specific Differences:

  • Tissue distribution patterns show some variation

  • Disease-specific expression patterns may differ

  • Pharmacological responses to antagonists may vary across species

Translational Research Implications:

  • Disease Modeling: The similarities in CCR4 biology make canine spontaneous disease models valuable for human translational research, particularly for:

    • Atopic dermatitis and allergic conditions

    • Cancer immunotherapy approaches targeting regulatory T cells

    • Neuroimmunological conditions involving CCR4-mediated immune cell trafficking

  • Cross-Reactivity of Reagents:

    • Human recombinant CCL2 can stimulate canine CCR4, facilitating translational studies

    • Some antagonists may work across species (e.g., C021)

    • Antibodies may require species-specific development

  • Therapeutic Development Pipeline:

    • Canine clinical trials can serve as stepping stones to human applications

    • Similar immune biomarkers (e.g., CCR4+ Treg infiltration) can be used across species

    • Comparative analysis of adverse effects provides additional safety data

The high degree of conservation makes canine CCR4-related research particularly valuable for human translational medicine, especially in naturally occurring disease models like canine atopic dermatitis and spontaneous tumors.

  • What are the most promising approaches for using recombinant CCR4 technology in development of immunotherapeutics for canine diseases?

Recombinant CCR4 technology offers several innovative approaches for canine immunotherapeutic development:

1. CCR4-CAR T Cell Therapy for Cancer:
Building on findings that CCL22 is highly expressed in tumor microenvironments , engineered T cells expressing chimeric antigen receptors targeting CCR4 could specifically eliminate CCR4+ regulatory T cells in tumors. This approach could reverse immunosuppression in canine cancers where Treg infiltration is mediated by CCR4 signaling.

2. CCR4-Redirected T Cell Therapy:
Based on research showing that transduction of cytotoxic T cells with CCR4 enhances their immigration into pancreatic cancer models , engineering tumor-specific T cells to express CCR4 could improve their trafficking to tumor sites that secrete CCR4 ligands like CCL22.

3. Bifunctional Fusion Proteins:
Development of molecules linking CCR4 ligands with immunostimulatory cytokines could specifically target immune activation to CCR4+ cell-rich environments in tumors or inflammatory sites.

4. CCR4 Decoy Receptors:
Soluble recombinant CCR4 could serve as a decoy receptor to sequester CCL17/CCL22/CCL2 in disease settings, reducing immune cell trafficking in conditions like atopic dermatitis where CCR4-dependent cell migration drives pathology .

5. Structure-Based Antagonist Design:
High-resolution structural data from recombinant canine CCR4 could facilitate rational design of species-specific antagonists with improved potency and reduced off-target effects compared to current molecules like C021 .

6. Biomarker Development:
Recombinant CCR4 can be used to develop standardized assays for measuring anti-CCR4 antibodies or soluble ligands in canine patients, enabling better patient selection and therapeutic monitoring in clinical trials.

Key Research Metrics for Evaluating These Approaches:

Therapeutic ApproachPrimary EndpointsValidation MethodsCurrent Research Status
CCR4-CAR T cellsReduction in tumor-infiltrating TregsFlow cytometry, functional assaysPreclinical development
CCR4-redirected T cellsEnhanced T cell migration to tumorsTracking labeled cells, tumor infiltrationProof of concept in murine models
CCR4 antagonistsReduced Treg trafficking, disease ameliorationMigration assays, clinical scoringValidated in vitro , in vivo testing ongoing
Biomarker applicationsCorrelation with disease statusSpecificity/sensitivity validationCorrelation established for CCL17 in atopic dermatitis

These approaches leverage our growing understanding of CCR4 biology in dogs to develop targeted therapies with potential for significant clinical impact.

Advanced Technical Questions

  • What are the critical quality control parameters for validating recombinant canine CCR4 preparations?

Ensuring the quality of recombinant canine CCR4 preparations requires comprehensive validation across multiple parameters:

Structural Integrity Assessment:

  • Purity Analysis: >90% purity by SDS-PAGE and size exclusion chromatography

  • Molecular Weight Confirmation: Precise molecular weight determination by mass spectrometry

  • Disulfide Bond Formation: Verification of correct disulfide bonding pattern by non-reducing vs. reducing SDS-PAGE

  • Post-translational Modifications: Glycosylation analysis if expressed in eukaryotic systems

Functional Validation:

  • Ligand Binding Assays: Determine binding affinities (KD) for canonical ligands (CCL17, CCL22) and non-canonical ligands (CCL2)

  • Receptor Activation: Measure calcium flux or GTPγS binding in reconstituted systems

  • Conformational Integrity: Reactivity with conformation-dependent antibodies

  • Thermal Stability: Differential scanning fluorimetry to assess protein stability

Production Consistency Parameters:

  • Batch-to-Batch Variation: Establish acceptance criteria for key parameters

  • Endotoxin Testing: <0.1 EU/mg for in vitro and in vivo applications

  • Stability Testing: Shelf-life determination under various storage conditions

  • Freeze-Thaw Stability: Assess activity retention after multiple freeze-thaw cycles

Application-Specific Testing:

  • Biological Activity: Chemotaxis assays using CCR4-expressing cells

  • Reconstitution Efficiency: For lyophilized preparations, verify complete reconstitution

  • Aggregation Analysis: Dynamic light scattering to detect protein aggregates

  • Host Cell Protein Content: Sensitive immunoassays for expression system-derived contaminants

Recommended Quality Control Workflow:

  • Initial characterization of reference standard lot

  • Establishment of release specifications based on reference standard

  • Routine testing of production lots against specifications

  • Periodic advanced characterization to verify continued consistency

These parameters ensure that recombinant canine CCR4 preparations maintain their structural integrity and functional activity, which is essential for reliable research applications.

  • How can researchers effectively troubleshoot expression and functional issues with recombinant canine CCR4?

Troubleshooting recombinant canine CCR4 expression and functionality requires systematic analysis of potential issues at each step of the experimental process:

Expression Issues:

ProblemPossible CausesTroubleshooting Approaches
Low expression levelCodon usage suboptimal for expression systemOptimize codons for expression host
Toxicity to host cellsUse inducible expression systems, lower induction levels
Protein instabilityInclude protease inhibitors, express at lower temperature
Inclusion body formationImproper foldingCo-express chaperones, optimize expression temperature
Hydrophobic transmembrane domainsUse fusion partners (MBP, thioredoxin) to enhance solubility
Degraded proteinProteolysisInclude protease inhibitors, modify vulnerable sites

Purification Issues:

ProblemPossible CausesTroubleshooting Approaches
Poor affinity tag bindingTag inaccessibilityReposition tag, use different tag or linker
Incorrect buffer conditionsOptimize pH, salt concentration
Aggregation during purificationDetergent concentration inadequateTest detergent screen, add stabilizing agents
Removal of stabilizing lipidsAdd lipids or use lipid nanodiscs
Low yield after purificationNon-specific binding to columnsAdjust washing conditions, include competitors
PrecipitationInclude stabilizers, optimize buffer composition

Functional Issues:

ProblemPossible CausesTroubleshooting Approaches
No ligand bindingMisfolded proteinVerify proper disulfide bonds, use conformational antibodies
Buffer incompatibilityAdjust pH, ions, add essential co-factors
Non-specific bindingSample contaminationIncrease purification stringency
AggregationCentrifuge samples, add solubilizers
No functional activityLoss of essential lipidsReconstitute in lipid environment
Missing co-receptorsCo-express with G proteins or other partners

Methodological Considerations:

  • For flow cytometry validation, include positive controls (CD4+CD25high T cells) known to express CCR4

  • For functional migration assays, compare results with cells expressing non-functional CCR4 mutants

  • For ligand binding assays, use both direct binding and competition approaches to distinguish specific from non-specific interactions

These troubleshooting approaches are supported by general principles of GPCR biochemistry and specific findings from canine chemokine receptor research .

  • What are the most significant advances and knowledge gaps in understanding signal transduction mechanisms of canine CCR4?

Current understanding of canine CCR4 signal transduction represents a complex landscape of established mechanisms and critical knowledge gaps:

Established Mechanisms:

  • G Protein Coupling: As a G protein-coupled receptor, canine CCR4 likely signals primarily through Gαi proteins, resulting in:

    • Inhibition of adenylyl cyclase and decreased cAMP levels

    • Activation of phospholipase C-β via Gβγ subunits

    • Mobilization of intracellular calcium

    • Activation of PI3K and MAP kinase pathways

  • Chemotactic Response Activation: CCR4 engagement leads to:

    • Integrin activation enhancing cell adhesion (demonstrated by increased binding of T cell LFA-1 to dendritic cell ICAM-1)

    • Cytoskeletal reorganization supporting directional migration

    • Enhanced T cell activation when CCR4 binds its ligands

  • Cross-talk with Other Receptors: Research has shown that:

    • CCR4 signaling can enhance T cell receptor signaling

    • CCR4 engagement strengthens integrin-mediated adhesion

Critical Knowledge Gaps:

  • Canine-Specific Signaling Differences: Limited research directly examining:

    • Species-specific differences in signaling cascades between canine and human CCR4

    • Unique phosphorylation patterns of the canine CCR4 C-terminus

    • Canine-specific protein interaction partners

  • Receptor Regulation: Poorly understood mechanisms of:

    • Internalization and trafficking of canine CCR4 after ligand binding

    • Receptor desensitization and resensitization kinetics

    • Role of β-arrestins in canine CCR4 signaling

  • Ligand Bias: Unknown aspects include:

    • Whether different ligands (CCL17, CCL22, CCL2) induce distinct signaling profiles through canine CCR4

    • Temporal dynamics of signaling responses to different ligands

    • How ligand concentration affects signaling outcomes

  • Tissue-Specific Signaling: Limited understanding of:

    • How the tissue microenvironment modifies CCR4 signaling

    • Cell type-specific signaling outcomes in different canine immune cells

    • Signaling differences in health versus disease states

Future Research Priorities:

  • Development of phospho-specific antibodies to track canine CCR4 activation

  • Proteomics studies to identify canine CCR4 interactome under different conditions

  • CRISPR-based studies to modify key residues and determine their roles in signaling

  • Comparative studies between human and canine CCR4 signaling in identical cellular contexts

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.