Recombinant Dog C-X-C chemokine receptor type 4 (CXCR4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have any specific requirements for the format, please specify your needs when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, and additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR4; C-X-C chemokine receptor type 4; CXC-R4; CXCR-4; CD antigen CD184
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MEELHIYPSDNYTEEDLGSGDYDSMKEPCFREENAHFNRIFLPTVYSIIFLTGIVGNGLV ILVMGYQKKLRSMTDKYRLHLSVADLLFVLTLPFWAVEAVANWYFGNFLCKAVHVIYTVN LYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVRE ADDRYICDRFYPNDSWLVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGYQKRKALK TTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFEKTVHKWISITEALAFFHCCLNP ILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Uniprot No.

Target Background

Function
CXCR4 is a receptor for the C-X-C chemokine CXCL12/SDF-1, which triggers signal transduction by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. It is involved in the AKT signaling cascade, playing a role in regulating cell migration, as observed during wound healing. CXCR4 acts as a receptor for extracellular ubiquitin, leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. It binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. CXCR4 participates in hematopoiesis and cardiac ventricular septum formation. It also plays a critical role in the vascularization of the gastrointestinal tract, likely by regulating vascular branching and/or remodeling processes in endothelial cells. Additionally, CXCR4 is involved in cerebellar development. In the CNS, it might mediate hippocampal-neuron survival.
Gene References Into Functions
  1. Interaction with CXCL12 to promote cell migration and invasion of hemangiosarcoma. PMID: 26337509
  2. Clusterin expression may increase cardiac progenitor cell migration via increasing CXCR4 expression and SDF-1/chemokine receptor signaling in a PI3/Akt-dependent manner. PMID: 20813109
  3. CXCR4 is ruled out as the cause of trapped neutrophil syndrome in Border Collies. PMID: 16441310
  4. The amino acid sequence encoding CXCR4 exhibits the structural characteristics of seven transmembrane domain G protein-coupled receptors. PMID: 17316828
  5. The expression of CXCR4 in canine immortalized cell lines and naturally occurring tumor samples, and its role in cell migration in cell lines, are reported. PMID: 18466248

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction. Early endosome. Late endosome. Lysosome.

Q&A

What is CXCR4 and what is its primary function in canine physiology?

CXCR4 is a G-protein-coupled chemokine receptor with seven membrane-spanning domains that primarily binds to C-X-C motif chemokine ligand 12 (CXCL12, also known as stromal cell-derived factor-1 or SDF-1). In normal canine physiology, CXCR4 regulates essential processes including embryogenesis, tissue repair, angiogenesis, and immune cell trafficking . The receptor transduces signals by increasing intracellular calcium levels and enhancing MAPK1/MAPK3 activation upon binding with CXCL12 . This signaling cascade orchestrates directional cell migration and is crucial for various physiological processes in dogs, similar to its function in other species .

How does the structure of canine CXCR4 compare to human CXCR4?

Canine CXCR4 shares significant structural homology with human CXCR4, particularly in the transmembrane domains and ligand-binding regions. Both function as seven-transmembrane G-protein-coupled receptors and interact with CXCL12 through similar binding interfaces . The amino-terminal domain and the second extracellular loop serve as critical binding sites in both species . This structural conservation explains why many experimental approaches and antibodies developed for human CXCR4 can often be adapted for canine research, although species-specific validation is always necessary for ensuring experimental accuracy .

What is the relationship between CXCR4 and its ligand CXCL12 in dogs?

The interaction between CXCR4 and its ligand CXCL12 in dogs initiates signaling cascades that regulate directional cell migration. Upon binding of CXCL12 to CXCR4 on canine cell membranes, there is mobilization of intracellular calcium and activation of downstream pathways including MAPK signaling . This interaction is critical for normal physiological processes but is also exploited during pathological conditions like cancer. In canine tumor cell lines, exogenous CXCL12 protein can significantly enhance migratory ability of CXCR4-positive cells, and this effect can be nullified by pre-treatment with CXCR4 antagonists like AMD3100 . Interestingly, there is often an inverse correlation between CXCR4 and CXCL12 gene expression in certain canine cancer cell lines, suggesting complex regulatory mechanisms .

What methods are most effective for detecting CXCR4 expression in canine tissues and cells?

Detection of CXCR4 in canine tissues and cells requires careful method selection and antibody validation. Based on published research, a multi-method approach yields the most reliable results:

  • Immunohistochemistry (IHC): Effective for tissue sections, though finding suitable antibodies for paraffin-embedded canine tissues can be challenging. Some researchers report difficulty in finding antibodies that reliably work in formalin-fixed canine tissues .

  • Immunocytochemistry (ICC): Successfully used to detect CXCR4 in canine cell lines, showing expression primarily in cell membranes and cytoplasm .

  • Flow cytometry: Provides quantitative assessment of surface CXCR4 expression and allows identification of CXCR4-bright populations .

  • Western blot analysis: Useful for total protein detection and semi-quantitative analysis of CXCR4 levels .

  • RT-PCR: Sensitive method for detecting CXCR4 mRNA expression, with established primer pairs (forward 5'-GAGCGGTTACCATGGAAGAG-3' and reverse 5'-CGGTTGAAGTGAGCATTTTCC-3') .

Antibody validation is critical, as expression patterns and intensity can vary between techniques. For optimal results, researchers should employ multiple detection methods and include appropriate positive and negative controls .

How does CXCR4 expression vary among different canine cell lines?

CXCR4 expression varies significantly among canine cell lines, both in terms of mRNA levels and protein expression. Research has documented this variation across several tumor types:

Mammary Gland Tumor (MGT) Cell Lines:

  • All three canine MGT cell lines studied (RCM-KI, RCM-SA, and RCM-SO) were CXCR4-positive by immunocytochemistry .

  • Expression was primarily observed in cell membranes and cytoplasm .

  • While all cells expressed CXCR4, there was variation in staining intensity across cells within the same line .

Osteosarcoma (OSA) Cell Lines:

  • All studied canine OSA cell lines expressed CXCR4 mRNA and protein .

  • Zoledronate treatment affected CXCR4 expression differently across cell lines: K003 cells showed significant reduction, while Abrams and HMPOS lines showed no consistent change .

Hemangiosarcoma (HSA) Cell Lines:

  • CXCR4 mRNA was abundant in SPAR and DD1 cells but expressed at very low levels in JLU and Emma cells .

  • An inverse correlation between CXCR4 and CXCL12 gene expression was observed in SPAR, DD1, and JLU cell lines .

  • Most cells in SPAR and DD1 lines showed detectable CXCR4 expression by flow cytometry .

These variations suggest cell line-specific regulation of CXCR4 expression and highlight the importance of characterizing each line before using it as a model system for studying CXCR4 biology .

What are the challenges in developing specific antibodies for canine CXCR4?

Developing and validating antibodies specific for canine CXCR4 presents several significant challenges:

  • Cross-reactivity issues: Despite structural homology between species, antibodies developed against human CXCR4 may not consistently recognize canine CXCR4 with high specificity .

  • Fixation sensitivity: Some researchers report difficulties finding antibodies that reliably work in formalin-fixed, paraffin-embedded canine tissues. For example, one study noted: "A limitation of this study was that we could not evaluate CXCR4 expression in canine MGT tissues as we could not find a suitable antibody to stain the paraffin-embedded canine tissues" .

  • Variable expression patterns: CXCR4 can be expressed at the cell membrane, in the cytoplasm, or both, complicating antibody detection depending on sample preparation methods .

  • Dynamic expression: Surface CXCR4 expression in canine cells appears to be dynamic and can be downregulated following exposure to certain compounds (like zoledronate) or after ligand binding, making consistent detection challenging .

  • Validation requirements: Proper validation requires multiple techniques (western blot, ICC, flow cytometry) and appropriate controls, which can be resource-intensive but is essential for reliable results .

To address these challenges, researchers should use multiple detection methods, validate antibodies across different sample types, and include appropriate controls to ensure specificity and reliability in their experimental systems .

What functional assays are available to study CXCR4 activity in canine cells?

Several functional assays have been validated for studying CXCR4 activity in canine cells:

  • Wound Healing/Scratch Assay: This method effectively measures the migratory response of CXCR4-positive canine cells to CXCL12 stimulation. In canine MGT cell lines, the percentage of wounded area filled with tumor cells was significantly higher when stimulated with CXCL12 compared to controls .

  • Transwell Migration Assay: This commercial assay evaluates directional migration of cells toward CXCL12 gradients. Studies in canine OSA cell lines showed that ligation of CXCR4 with exogenous CXCL12 results in enhanced directional migration .

  • Calcium Mobilization Assay: Since CXCR4 activation leads to intracellular calcium release, calcium flux assays can measure receptor functionality. In canine HSA cells, CXCL12 stimulation induced intracellular calcium mobilization proportional to CXCR4 expression levels .

  • Cell Invasion Assays: These assess the ability of CXCR4-positive canine cells to invade through extracellular matrix components in response to CXCL12, providing insights into metastatic potential .

  • CXCR4 Antagonist Studies: Functional responses can be validated by pre-treating cells with CXCR4-specific antagonists like AMD3100, which should inhibit CXCL12-induced effects .

The combined use of these assays provides comprehensive insights into CXCR4 functionality in canine cells and allows for mechanistic studies of CXCR4/CXCL12-mediated cell behavior .

How does the CXCL12/CXCR4 signaling axis influence canine tumor cell migration?

The CXCL12/CXCR4 signaling axis plays a crucial role in promoting canine tumor cell migration through several mechanisms:

  • Direct stimulation of migratory machinery: In canine mammary gland tumor (MGT) cell lines, exogenous CXCL12 significantly enhances migration in wound healing assays. In RCM-KI and RCM-SA cell lines, the percentage of wounded area filled with tumor cells was significantly higher when stimulated with CXCL12 compared to controls without CXCL12 protein .

  • G-protein-coupled signaling activation: Upon binding CXCL12, CXCR4 activates heterotrimeric G-proteins, particularly involving the γ5 subunit. This activation triggers downstream signaling cascades including MAPK pathways that regulate cytoskeletal reorganization and directional migration .

  • Calcium mobilization: CXCL12 stimulation induces intracellular calcium mobilization in CXCR4-positive canine cells, a process critical for initiating migratory responses .

  • Pathway specificity: The migration-promoting effect of CXCL12 can be specifically attributed to CXCR4 activation, as demonstrated by inhibition studies using the CXCR4-specific antagonist AMD3100. Pre-treatment with AMD3100 significantly reduces the migration of canine tumor cells in response to CXCL12 stimulation .

These findings suggest that the CXCL12/CXCR4 axis is an important mediator of directional migration in canine tumor cells, potentially contributing to invasion and metastasis in canine cancers .

What downstream signaling pathways are activated by CXCR4 in canine cells?

CXCR4 activation in canine cells triggers multiple downstream signaling pathways that regulate critical cellular functions:

  • MAPK Signaling: CXCL12 binding to CXCR4 enhances MAPK1/MAPK3 (ERK1/2) activation. In CXCR4-positive canine cells, CXCL12 stimulation leads to increased ERK1/2 phosphorylation, which can be blocked by CXCR4 antagonists .

  • PI3K/Akt Pathway: CXCR4 engagement activates the PI3K/Akt signaling cascade in canine cells. CXCL12 stimulation of 100 ng/mL for 5 minutes has been shown to induce Akt activation, which can be inhibited by CXCR4 blockade .

  • Calcium Signaling: CXCR4 activation triggers intracellular calcium mobilization, a critical second messenger for multiple cellular processes including migration .

  • G-protein Signaling: CXCR4 couples to heterotrimeric G-proteins, particularly involving the γ5 subunit which requires prenylation for proper function. Disruption of this process (e.g., by zoledronate) impairs CXCR4-mediated signaling in canine cells .

  • Cytoskeletal Reorganization Pathways: CXCR4 activation initiates signaling cascades responsible for cytoskeletal organization and directional migration, which can be observed in functional assays of cell movement .

The specific contribution of each pathway may vary by cell type and context. For example, in canine osteosarcoma cells, zoledronate can disrupt CXCR4 signaling by inhibiting prenylation of heterotrimeric G-proteins, particularly affecting the γ5 subunit . Understanding these pathways provides insights into potential therapeutic targets for disrupting CXCR4-mediated processes in canine disease .

How does CXCR4 expression correlate with metastatic potential in canine cancers?

CXCR4 expression shows complex correlations with metastatic potential in canine cancers, with patterns varying by tumor type:

Osteosarcoma (OSA):

  • The majority (8/11, 73%) of primary canine OSA tumors express CXCR4 protein .

  • Interestingly, only a minority (2/8, 25%) of pulmonary metastases retain CXCR4 expression .

  • This suggests CXCR4 might be important for initial metastatic processes but may not be required for maintenance of established metastases in OSA .

Mammary Gland Tumors (MGT):

  • CXCL12 expression was identified in all examined malignant MGT tissues, though with varying staining patterns and intensities .

  • CXCR4-positive MGT cells show enhanced migration in response to CXCL12, suggesting a potential role in invasion and metastasis .

  • The CXCL12/CXCR4 axis is associated with the migration of canine MGT cells, potentially contributing to local invasion and distant metastasis .

Hemangiosarcoma (HSA):

  • CXCR4/CXCL12 signaling promotes cell migration and invasion in canine HSA cells .

  • Differences in CXCR4 expression might contribute to the diverse and unpredictable metastatic patterns observed in canine HSA .

What differences exist in CXCR4 expression between primary tumors and metastases in dogs?

Research has revealed intriguing differences in CXCR4 expression between primary tumors and metastases in canine cancers:

Osteosarcoma (OSA):

  • A significant disparity exists in CXCR4 expression between primary tumors and metastatic sites.

  • The majority (8/11, 73%) of primary canine OSA tumors express CXCR4 protein .

  • In contrast, only a minority (2/8, 25%) of pulmonary metastases maintain CXCR4 expression .

  • This suggests a dynamic regulation of CXCR4 during the metastatic process, with possible downregulation after successful colonization of distant sites.

Other Canine Cancers:

These observations suggest that CXCR4 may play a more critical role in early metastatic events (invasion, intravasation, and homing to distant sites) than in the maintenance and growth of established metastases in some canine cancers . This pattern differs from some human cancers, where CXCR4 expression often remains high in metastases, highlighting potential species-specific differences in the metastatic process .

How does CXCR4 expression vary across different types of canine tumors?

CXCR4 expression varies significantly across different types of canine tumors, with distinct patterns observed in various cancer types:

Mammary Gland Tumors (MGT):

  • CXCR4 is consistently expressed in canine MGT cell lines, with expression primarily observed in cell membranes and cytoplasm .

  • All examined malignant MGT tissues showed CXCL12 expression, though with varying staining patterns and intensities .

  • Three canine MGT cell lines (RCM-KI, RCM-SA, and RCM-SO) were confirmed CXCR4-positive by immunocytochemistry .

Osteosarcoma (OSA):

  • The majority (73%) of primary canine OSA tumors express CXCR4 .

  • All studied canine OSA cell lines express CXCR4 mRNA and protein, with expression detected through multiple techniques .

  • OSA shows dynamic CXCR4 expression, with higher prevalence in primary tumors (73%) compared to pulmonary metastases (25%) .

Hemangiosarcoma (HSA):

  • CXCR4 expression is variable across canine HSA cell lines .

  • SPAR and DD1 HSA cell lines show abundant CXCR4 mRNA, while JLU and Emma cell lines express very low levels .

  • An inverse correlation between CXCR4 and CXCL12 gene expression has been observed in some HSA cell lines (SPAR, DD1, and JLU) .

These patterns suggest tumor-specific regulation of CXCR4 expression, which may reflect differences in the biological behavior and metastatic potential of various canine cancers . The heterogeneity of CXCR4 expression within and between tumor types underscores the complexity of chemokine signaling in cancer and highlights the need for tumor-specific approaches when considering CXCR4 as a therapeutic target .

How effective are CXCR4 antagonists in blocking canine CXCR4 function?

CXCR4 antagonists have demonstrated significant efficacy in blocking canine CXCR4 function across multiple experimental systems:

AMD3100 (Plerixafor):

  • In canine mammary gland tumor (MGT) cell lines, pre-treatment with AMD3100 effectively canceled the CXCL12-induced enhancement of cell migration in wound healing assays .

  • Cells pre-treated with AMD3100 had a lower percentage of wounded area filled when stimulated with CXCL12 protein compared to non-treated cells .

Anti-CXCR4 Antibodies:

  • Neutralizing anti-CXCR4 antibodies have been shown to reduce CXCR4 surface expression and block migration toward CXCL12 in experimental systems .

  • Incubation with anti-CXCR4 antibodies (100 μg/mL for 30 minutes) significantly reduces CXCR4 surface staining as measured by flow cytometry .

  • CXCR4-blocked cells show inhibited signaling responses to CXCL12 stimulation, including reduced Akt and ERK1/2 activation .

Functional Confirmation:

  • Migration assays demonstrate that CXCR4 antagonism effectively blocks chemotaxis toward both recombinant CXCL12 and stromal cells that naturally produce CXCL12 .

  • The specificity of these antagonists for CXCR4-mediated effects is confirmed by their ability to block CXCL12-induced responses without affecting baseline cellular functions .

These findings suggest that CXCR4 antagonists can effectively block canine CXCR4 function in experimental settings and may have potential as therapeutic agents for targeting CXCR4-mediated processes in canine diseases, particularly cancers with elevated CXCR4 expression .

What is the impact of zoledronate on CXCR4 expression and function in canine tumor cells?

Zoledronate exerts complex effects on CXCR4 expression and function in canine tumor cells, with cell line-specific responses:

Impact on CXCR4 Expression:

  • Cell line-dependent responses: Zoledronate reduces CXCR4 expression in some canine osteosarcoma (OSA) cell lines (K003) but has no consistent effect on others (Abrams, HMPOS) .

  • In K003 cells, zoledronate exposure (1-5 μM for 48 hours) reduced CXCR4 expression by >50% as demonstrated by western blot analysis .

  • Quantitative confocal fluorescent microscopy confirmed significant reductions in normalized CXCR4 fluorescent expression: 104.6 ± 25.3, 86.3 ± 21.2, and 75.6 ± 18.4 RFU/μm² for untreated control, 1 μM zoledronate, and 5 μM zoledronate respectively (P < 0.01) .

Mechanism of Action:

  • Zoledronate appears to reduce CXCR4 expression through two primary mechanisms:

    • Augmented proteasome degradation of CXCR4 protein

    • Reduced prenylation of heterotrimeric G-proteins, particularly affecting the γ5 subunit which requires prenylation for proper membrane localization and function

  • The effect on G-protein prenylation can be rescued by co-incubation with geranylgeraniol (GGOH), confirming zoledronate's mechanism via inhibition of farnesyl pyrophosphate synthetase (FPPS) .

In Vivo Effects:

  • In dogs with OSA, zoledronate treatment reduces CXCR4 expression by approximately 40% within the primary tumor compared to untreated controls (P = 0.03) .

  • Zoledronate decreases circulating concentrations of CXCR4 in 90% (18/20) of dogs with OSA .

  • These changes may potentially alter natural patterns of metastasis, though larger clinical studies are needed to confirm this hypothesis .

These findings suggest that zoledronate may serve as a potential adjuvant therapy for modulating CXCR4-mediated processes in certain canine cancers, particularly in tumors where CXCR4 plays a significant role in invasion and metastasis .

How might targeting CXCR4 affect metastatic patterns in canine cancers?

Targeting CXCR4 may significantly alter metastatic patterns in canine cancers through several mechanisms:

Disruption of Directional Migration:

  • CXCR4 antagonism inhibits CXCL12-directed tumor cell migration, which could prevent homing of circulating tumor cells to tissues with high CXCL12 expression .

  • Since CXCR4/CXCL12 signaling mediates tissue-specific metastasis, blocking this axis may alter the distribution of metastatic lesions .

Zoledronate-Mediated Effects:

  • In dogs with osteosarcoma treated with zoledronate, researchers observed "qualitatively atypical metastases" compared to standard patterns .

  • Zoledronate reduces CXCR4 expression in both primary tumors (~40% reduction) and systemic circulation in the majority of treated dogs .

  • These changes may contribute to altered metastatic behaviors, though researchers note that "it is not possible to ascribe the anatomic changes in metastatic colonization as a direct effect of reduced CXCR4 expression secondary to zoledronate exposure" .

Potential Clinical Implications:

  • Blockade of CXCR4 may delay or modify metastatic progression rather than completely preventing it, as suggested by zoledronate studies where researchers proposed the drug might be used "as an adjuvant therapy for changing, and ideally delaying, the onset of metastatic progression in dogs with OS" .

  • The heterogeneous expression of CXCR4 across tumor types and the dynamic regulation during metastasis (higher in primary tumors than in established metastases in some cancers) suggest that timing of CXCR4-targeted therapies may be critical for efficacy .

What are the technical challenges in producing functional recombinant canine CXCR4 for research applications?

Producing functional recombinant canine CXCR4 for research applications presents several significant technical challenges:

Membrane Protein Expression Systems:

  • As a seven-transmembrane G-protein coupled receptor, CXCR4 requires specialized expression systems that maintain proper membrane insertion, folding, and post-translational modifications .

  • Conventional bacterial expression systems often fail to produce properly folded membrane proteins, necessitating the use of eukaryotic systems such as HEK293F cells, insect cells, or specialized bacterial strains .

Post-translational Modifications:

  • Functional CXCR4 requires specific post-translational modifications including glycosylation and disulfide bond formation that affect ligand binding and signaling .

  • Ensuring these modifications occur correctly in recombinant systems is technically challenging but essential for producing functionally relevant protein .

Protein Stability and Solubilization:

  • Maintaining stability of recombinant CXCR4 outside its native membrane environment typically requires detergents or lipid nanodiscs that preserve the native conformation while allowing solubilization .

  • The choice of detergent or lipid environment significantly impacts receptor functionality and must be optimized for specific applications .

Functional Validation:

  • Confirming that recombinant canine CXCR4 retains proper ligand binding and signaling capabilities requires specialized assays including:

    • Ligand binding assays with recombinant CXCL12

    • G-protein coupling assays

    • Calcium mobilization assays

    • Conformational antibody binding

Species-Specific Considerations:

  • While canine CXCR4 shares significant homology with human CXCR4, species-specific differences in glycosylation patterns and subtle structural variations may affect receptor function .

  • Validation using canine-specific reagents and cell systems is necessary to ensure relevance to canine biology .

Addressing these challenges typically requires specialized expertise in membrane protein biochemistry and may explain why many researchers opt to study endogenous CXCR4 in canine cell lines rather than working with purified recombinant protein for functional studies .

How do expression patterns of CXCR4 in canine tumor models compare with human cancer models?

Expression patterns of CXCR4 in canine tumor models share important similarities with human cancer models, but also exhibit some notable differences:

Similarities:

  • Widespread expression across cancer types: Both canine and human tumors show CXCR4 expression across multiple cancer types including mammary/breast cancer, osteosarcoma, and vascular tumors .

  • Functional role in migration and metastasis: In both species, CXCR4 activation by CXCL12 promotes directional migration and invasion of cancer cells, contributing to metastatic potential .

  • Heterogeneous expression within tumors: Both canine and human tumors demonstrate heterogeneity in CXCR4 expression levels between different cells within the same tumor .

  • Response to CXCR4 antagonists: Canine and human cancer cells show similar functional responses to CXCR4 antagonists like AMD3100, with inhibition of CXCL12-directed migration and signaling .

Differences:

What are the contradictions in published data regarding CXCR4 function in different canine cancer cell lines?

Several notable contradictions and inconsistencies exist in the published literature regarding CXCR4 function in different canine cancer cell lines:

Expression Level Discrepancies:

  • Conflicting reports exist regarding CXCR4 expression in certain canine tumor cell lines. For instance, one study reported: "In another study evaluating CXCR4 expression in various canine tumor cell lines, including the MGT cell line CMT28, no endogenous CXCR4 mRNA expression was detected" . This contradicts findings from other studies showing widespread CXCR4 expression in canine tumor cell lines .

Variable Response to CXCL12 Stimulation:

Differential Sensitivity to Zoledronate:

  • Cell lineage susceptibility to zoledronate-induced alterations in CXCR4 varies unpredictably. The K003 osteosarcoma cell line showed significant reductions in CXCR4 expression following zoledronate treatment, while Abrams and HMPOS cell lines showed no consistent change despite similar baseline FPPS expression levels .

  • This inconsistency suggests additional regulatory mechanisms beyond the presumed zoledronate target (FPPS) contribute to CXCR4 regulation .

CXCR4/CXCL12 Expression Relationships:

Methodological Challenges:

  • Discrepancies in antibody validation and detection methods contribute to contradictory findings. One study noted: "we could not evaluate CXCR4 expression in canine MGT tissues as we could not find a suitable antibody to stain the paraffin-embedded canine tissues" , highlighting technical limitations that may explain some contradictions in the literature.

These contradictions underscore the complexity of CXCR4 biology in canine cancer and highlight the need for standardized methodologies, careful validation of reagents, and consideration of cell line-specific factors when interpreting experimental results .

How can researchers accurately quantify CXCR4 protein levels in canine samples for comparative studies?

Accurate quantification of CXCR4 protein levels in canine samples requires a multi-faceted approach that addresses several technical challenges:

Validated Western Blot Protocol:

  • Optimize protein extraction protocols specifically for membrane proteins like CXCR4.

  • Use verified antibodies with confirmed specificity for canine CXCR4 (several studies have validated specific antibodies) .

  • Include appropriate positive controls (e.g., canine cell lines with confirmed CXCR4 expression) and negative controls.

  • Employ densitometry analysis with normalization to stable housekeeping proteins or total protein staining.

  • Consider that CXCR4 often appears at multiple molecular weights due to glycosylation and may require deglycosylation treatments for accurate quantification .

Flow Cytometry Quantification:

  • Use calibrated fluorescent beads to establish a standard curve relating fluorescence intensity to antibody binding sites.

  • Measure surface CXCR4 using properly titrated, directly conjugated antibodies validated for canine CXCR4.

  • Report quantitative metrics such as Molecules of Equivalent Soluble Fluorochrome (MESF) or antibody binding capacity rather than arbitrary fluorescence units.

  • Consider the dynamics of CXCR4 expression by specifically quantifying "CXCR4-bright" cells (defined as expression >10 times isotype control) .

Quantitative Immunohistochemistry/Immunocytochemistry:

  • Use digital image analysis with appropriate controls for background subtraction.

  • Normalize fluorescent CXCR4 expression to cell area (RFU/μm²) for accurate cell-to-cell comparisons .

  • Score staining patterns using validated scales that consider both intensity and distribution.

  • Include tissue microarrays with known CXCR4 expression levels as internal standards across experiments.

Mass Spectrometry-Based Approaches:

  • Employ targeted proteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM) with isotopically labeled peptide standards.

  • Focus on CXCR4-specific peptides that are conserved in canine samples but can be distinguished from other species.

  • Use enrichment strategies for membrane proteins to enhance detection sensitivity.

Validation Across Methods:
To ensure accuracy in comparative studies, researchers should validate measurements across at least two independent quantification methods and report correlation between techniques .

By implementing these rigorous approaches, researchers can generate reliable quantitative data on CXCR4 protein levels in canine samples suitable for comparative studies across different tumor types or between canine and human samples .

What are the key considerations for designing a CXCR4 knockout or knockdown experiment in canine cell lines?

Designing effective CXCR4 knockout or knockdown experiments in canine cell lines requires careful consideration of several key factors:

Selection of Appropriate Genetic Modification Approach:

  • CRISPR-Cas9 for Knockout:

    • Design canine-specific guide RNAs targeting conserved exons of CXCR4

    • Target early exons to ensure complete protein disruption

    • Validate guide RNAs for minimal off-target effects in the canine genome

    • Consider potential compensation by other chemokine receptors after complete knockout

  • shRNA/siRNA for Knockdown:

    • Design canine-specific sequences based on verified mRNA sequences

    • Test multiple target sequences to identify optimal knockdown efficiency

    • For stable knockdown, use inducible systems to control expression levels

    • Consider the dynamic range of knockdown (partial vs. near-complete)

Rigorous Validation of Modification:

  • Genomic Validation:

    • For CRISPR: Sequence the targeted locus to confirm mutations

    • Verify that introduced frameshift or deletion affects all alleles

  • Expression Validation:

    • Confirm reduction at mRNA level via RT-qPCR with validated primers (e.g., forward 5'-GAGCGGTTACCATGGAAGAG-3' and reverse 5'-CGGTTGAAGTGAGCATTTTCC-3')

    • Verify protein reduction via Western blot, flow cytometry, and immunocytochemistry

    • Quantify the degree of knockdown/knockout relative to wild-type and control-treated cells

  • Functional Validation:

    • Confirm loss of CXCL12-induced calcium mobilization

    • Verify impaired migration toward CXCL12 gradients

    • Assess impact on downstream signaling (ERK1/2 and Akt phosphorylation)

Experimental Design Considerations:

  • Appropriate Controls:

    • Use non-targeting guides/shRNAs with similar delivery methods

    • Include isogenic wild-type controls

    • Consider rescue experiments with exogenous CXCR4 expression to confirm specificity

  • Cell Line Selection:

    • Choose lines with confirmed endogenous CXCR4 expression and functional responses to CXCL12

    • Consider using multiple cell lines to address the heterogeneity observed across canine tumor types

    • Be aware of potential compensation mechanisms in different genetic backgrounds

  • Phenotypic Assays:

    • Design assays that specifically measure CXCR4-dependent functions (migration, invasion, calcium flux)

    • Include positive controls (AMD3100 treatment) to confirm specificity

    • Consider both short-term and long-term phenotypic consequences of CXCR4 disruption

By carefully addressing these considerations, researchers can generate reliable CXCR4 knockout or knockdown models in canine cell lines that provide valuable insights into the receptor's role in normal and pathological processes .

Table 2: Effects of CXCL12 on Migration in CXCR4-Positive Canine Cancer Cell Lines

Cell LineCancer TypeAssay TypeCXCL12 ConcentrationMigration ResponseInhibition by AMD3100Reference
RCM-KIMammary Gland TumorWound HealingNot specifiedSignificant increase (p < 0.05)Yes
RCM-SAMammary Gland TumorWound HealingNot specifiedSignificant increase (p < 0.05)Yes
RCM-SOMammary Gland TumorWound HealingNot specifiedIncrease (not significant)Yes
K003OsteosarcomaMigration AssayNot specifiedSignificant increaseNot reported
SPARHemangiosarcomaMigration & InvasionNot specifiedSignificant increaseYes
DD1HemangiosarcomaMigration & InvasionNot specifiedSignificant increaseYes
Various OSA linesOsteosarcomaCommercial Migration AssayNot specifiedDirectional migrationNot reported
Raji transfectantsControl cell lineMigration Assay100 ng/mLSignificant increaseYes (anti-CXCR4 antibody)

Table 3: Impact of Zoledronate on CXCR4 Expression and Function in Canine Osteosarcoma

ParameterK003 Cell LineAbrams Cell LineHMPOS Cell LineIn Vivo (Dog Tumors)Reference
CXCR4 Expression Change with 1μM Zoledronate↓ to 86.3 ± 21.2 RFU/μm² (p < 0.01)No consistent changeNo consistent change↓ by 40% (p = 0.03)
CXCR4 Expression Change with 5μM Zoledronate↓ to 75.6 ± 18.4 RFU/μm² (p < 0.01)No consistent changeNo consistent changeNot tested
Western Blot Analysis>50% decreaseNo consistent changeNo consistent changeNot reported
CXCR4 FunctionalitySignificantly reducedNot significantly affectedNot significantly affectedNot directly measured
G-protein γ5 ExpressionReducedNot reportedNot reportedNot reported
Rescue with GGOHComplete restoration of γ5Not applicableNot applicableNot applicable
Circulating CXCR4 ConcentrationNot applicableNot applicableNot applicableDecreased in 18/20 dogs (90%)
Effect on Metastatic PatternNot applicableNot applicableNot applicable"Qualitatively atypical metastases"

RFU/μm²: Relative Fluorescence Units per square micrometer; GGOH: Geranylgeraniol (metabolite that can be converted into isoprenoid pyrophosphates)

CXCR4 Expression in Primary Tumors vs. Metastases in Canine Osteosarcoma

Tissue TypeNumber CXCR4-PositiveTotal NumberPercentageDetection MethodReference
Primary Tumors81173%Immunocytochemistry
Pulmonary Metastases2825%Immunohistochemistry

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.