Recombinant Dog Calnexin (CANX)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dog Calnexin (CANX)

Recombinant Dog Calnexin (CANX) is a bioengineered protein derived from Canis lupus familiaris (domestic dog) and produced through bacterial expression systems. It belongs to the calreticulin family of calcium-binding molecular chaperones and plays a critical role in glycoprotein folding and quality control within the endoplasmic reticulum (ER) . This protein is characterized by its transmembrane structure, with a lumenal calcium-binding domain, a single-pass transmembrane helix, and a cytoplasmic tail .

Protein Architecture

Recombinant Dog Calnexin is a full-length protein spanning amino acids 21–593, with a predicted molecular weight of ~67.6 kDa . Key structural features include:

  • Lumenal Domain: A calcium-binding region critical for interacting with monoglucosylated glycoproteins during folding .

  • Transmembrane Helix: Anchors the protein to the ER membrane .

  • Cytoplasmic Tail: A short acidic region involved in protein-protein interactions .

Biological Function

  • ER Quality Control: Retains misfolded glycoproteins in the ER, ensuring proper folding or degradation .

  • Calcium Sensitivity: Binds calcium ions, which modulate its chaperone activity .

  • Cross-Species Reactivity: Shares conserved sequences with human, mouse, and rat Calnexin, enabling broad experimental utility .

Production and Purification

Recombinant Dog Calnexin is typically expressed in E. coli with an N-terminal His-tag for affinity purification. Key production parameters include:

ParameterSpecification
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE validated)
Storage-20°C/-80°C in Tris/PBS-based buffer with 50% glycerol
ReconstitutionResuspend in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol

Biochemical Assays

Recombinant Dog Calnexin is used in:

  • SDS-PAGE: Validates protein integrity and purity .

  • ELISA Kits: Quantifies endogenous Calnexin levels in canine serum, plasma, or tissue homogenates .

Cross-Species Insights

Studies on human Calnexin reveal its dual role in enhancing productivity (q p) and promoting apoptosis under stress . These findings suggest recombinant Dog Calnexin could similarly modulate cellular responses in canine models.

Technical Considerations

  • Stability: Avoid repeated freeze-thaw cycles to prevent degradation .

  • Specificity: Ensure compatibility with detection systems (e.g., anti-His antibodies) .

  • Quantification: ELISA kits (e.g., CNEB0073) enable precise measurement of Calnexin levels in canine samples .

Table 2: ELISA Kit Components (CNEB0073)

ComponentDescription
Microplate96-well strips for calnexin detection
StandardsLyophilized calnexin controls for calibration
Detection ReagentsEnzyme-linked antibodies and chromogenic substrates for signal detection

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
CANX; Calnexin; pp90
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-593
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
HEGHDDDMIDIEDDLDDVIEEVEDSKSKPDTSAPTSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSIVNSGNLLNDMTPPVNPSREIEDPEDQKPEDWDERPKIPDPDAVKPDDWNEDAPAKIPDEEATKPDGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIVCGDRRVVDDWANDGWGLKKAADGAAEPGVVGQMIEAAEERPWLWVVYVLTVALPVFLVILFCCSGKKQSSPVEYKKTDAPQPDVKEEEEEKEEEKDKGDEEEEGEEKLEEKQKSDAEEDGGTASQEEDDRKPKAEEDEILNRSPRNRKPRRE
Uniprot No.

Target Background

Function

Calnexin is a calcium-binding protein that interacts with newly synthesized glycoproteins within the endoplasmic reticulum (ER). It assists in protein assembly and retention of unassembled subunits within the ER. A key component of the ER quality control system, it retains incorrectly folded proteins. Its association with partial T-cell antigen receptor complexes escaping the ER of immature thymocytes suggests a role in signaling complexes regulating thymocyte maturation. Additionally, calnexin may participate in receptor-mediated endocytosis at the synapse.

Gene References Into Functions
  1. Calnexin shuttles between the rough ER and the mitochondria-associated membrane, a process dependent on its palmitoylation status. PMID: 22045338
  2. A small peptide derived from the P-domain of calnexin exhibits binding activity with the endoplasmic reticulum protein p61. PMID: 14988724
  3. The lectin and arm domains of calnexin contribute distinctly to its molecular chaperone function. PMID: 19074423
Database Links
Protein Families
Calreticulin family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Endoplasmic reticulum. Melanosome.

Q&A

What is dog calnexin (CANX) and what are its primary functions in cellular biology?

Dog calnexin (CANX) is a calcium-binding integral membrane protein located in the endoplasmic reticulum (ER) that functions as a molecular chaperone. It plays several crucial roles:

  • Interacts with newly synthesized monoglucosylated glycoproteins in the endoplasmic reticulum

  • Assists in proper protein assembly and folding of nascent glycoproteins

  • Retains unassembled or incorrectly folded protein subunits within the ER to prevent their premature transport

  • Serves as a key component of the ER quality control apparatus by identifying and processing misfolded proteins

  • May participate in receptor-mediated endocytosis at synaptic junctions

The dog calnexin protein has a molecular weight of approximately 61.4 kDa and contains multiple conserved domains including casein kinase II phosphorylation sites that are critical for its function .

What expression systems are most effective for producing recombinant dog CANX?

Escherichia coli is the most commonly documented expression system for producing recombinant dog CANX, though each system offers distinct advantages:

E. coli expression system:

  • Allows successful expression of full-length dog calnexin (amino acids 21-593) with N-terminal His-tag

  • Enables high yields of recombinant protein under optimized conditions

  • Provides tight control of expression using IPTG induction under T7 promoter systems

  • Western blot analysis confirms proper expression of the full-length protein at the expected molecular weight

For optimal expression in E. coli:

  • Transform expression vectors (such as pET28a) containing the dog CANX sequence into BL21(DE3) competent cells

  • Induce expression using IPTG (typically 100 μM)

  • Express for approximately 1 hour for initial protein production

  • Confirm expression via SDS-PAGE and Western blot analysis

Other potential expression systems include mammalian cell lines and insect cells, which may better preserve post-translational modifications though these are not explicitly covered in the provided search results.

What are the optimal storage conditions for maintaining recombinant dog CANX stability?

Proper storage of recombinant dog CANX is critical for maintaining its biological activity and stability:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to prevent repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • For reconstitution, use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL

  • Add glycerol (5-50% final concentration) to reconstituted protein before long-term storage

  • The default recommended final concentration of glycerol is 50%

Buffer composition:

  • Maintain in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

These storage conditions are essential for preserving protein structure and function during experimental timeframes.

What detection methods provide the highest sensitivity for quantifying dog CANX in experimental samples?

Several complementary methods can be employed for detecting and quantifying dog CANX with varying sensitivity thresholds:

Western Blot Analysis:

  • Provides sensitive detection of recombinant CANX in purified samples and complex mixtures

  • Recommended antibody dilution: 1/1000 for optimal detection

  • Allows visualization of full-length protein (~75 kDa for His-tagged recombinant protein)

  • Can be used to confirm successful expression and purification

ELISA-Based Quantification:

  • Dog Calnexin ELISA kits offer high sensitivity and specificity for quantitative measurements

  • Suitable for detection in serum, plasma, and cell culture supernatants

  • Provides precise concentration measurements with consistent results

  • Intra- and inter-assay CV data provided with commercial kits

PCR-Based Expression Analysis:

  • RT-PCR and qPCR can be used to measure CANX mRNA expression levels

  • Normalization against housekeeping genes (e.g., actin) is essential

  • Quantification can be performed using the 2^-ΔΔCT method

  • Appropriate for studying transcriptional regulation of CANX under different conditions

For comprehensive analysis, combining protein-level detection (Western blot, ELISA) with transcript-level analysis (RT-PCR, qPCR) provides the most complete picture of CANX expression and regulation.

How can researchers effectively design expression vectors for dog CANX studies?

Successful expression vector design for dog CANX requires careful consideration of several key factors:

Essential vector elements:

  • Strong promoter (e.g., T7 promoter for bacterial expression)

  • Appropriate fusion tags (e.g., His-tag for purification)

  • Tag placement (typically N-terminal for CANX)

  • Inclusion of appropriate restriction sites for cloning (e.g., NcoI, XhoI)

  • Removal of stop codons when creating fusion proteins

Cloning strategy:

  • Design primers with flanking restriction sites (e.g., NcoI in forward primer, XhoI in reverse primer)

  • Amplify the dog CANX coding sequence without stop codons if C-terminal tags are desired

  • Insert the amplified sequence into an expression vector (e.g., pET-28a)

  • Transform the recombinant vector into competent cells

  • Confirm correct insertion and orientation by DNA sequencing

The full-length dog CANX sequence (amino acids 21-593) has been successfully expressed in E. coli using this approach, yielding functional protein .

What experimental approaches can be used to evaluate the chaperone activity of recombinant dog CANX?

Evaluating the chaperone activity of recombinant dog CANX requires specialized assays that measure its ability to assist in protein folding:

Protein folding assays:

  • Monitor the folding of model substrate proteins in the presence vs. absence of recombinant CANX

  • Measure aggregation prevention using light scattering techniques

  • Assess binding to unfolded proteins using co-immunoprecipitation or pull-down assays

Stress response evaluation:

  • Express recombinant CANX in heterologous systems (e.g., E. coli) and expose to stress conditions

  • Measure survival rates under radiation or other stressors

  • Compare viability of cells expressing CANX vs. control cells

Specific methodology from research:

  • Transform E. coli BL21(DE3) with recombinant CANX-expressing vectors

  • Induce expression with IPTG (100 μM)

  • Subject cells to stress conditions (e.g., UV-B or gamma irradiation)

  • Perform plate assays to quantify cell viability compared to control cells

  • Analyze protective effects provided by CANX expression

This approach has demonstrated that calnexin can enhance tolerance to irradiation stress, suggesting its protective role under adverse conditions .

What approaches can be used to study post-translational modifications of dog CANX and their impact on function?

Post-translational modifications (PTMs) significantly influence CANX function, requiring specialized analytical approaches:

Relevant PTMs in dog CANX:

  • Phosphorylation at conserved casein kinase II sites

  • Glycosylation patterns that may affect folding and stability

  • Calcium binding that regulates chaperone activity

Analytical methods for PTM characterization:

  • Mass spectrometry-based approaches:

    • LC-MS/MS analysis for identification and mapping of phosphorylation sites

    • Glycopeptide analysis to characterize glycosylation patterns

    • Comparison of PTMs between recombinant and native dog CANX

  • Site-directed mutagenesis:

    • Mutate specific CK2 phosphorylation sites identified in the sequence

    • Four highly conserved CK2 sites (D277, D290, E333, and T440) are particularly important targets

    • Evaluate functional consequences of PTM-site mutations

  • Functional assays:

    • Compare activity of differently modified CANX variants

    • Assess calcium binding using techniques like isothermal titration calorimetry

    • Evaluate chaperone function with differently phosphorylated forms

These approaches help elucidate how specific modifications regulate dog CANX function in different cellular contexts and under various stress conditions.

How can recombinant dog CANX be utilized to develop models for studying ER stress in canine diseases?

Recombinant dog CANX provides a valuable tool for developing models of ER stress-related conditions:

Experimental approaches:

  • Cell-based models:

    • Express recombinant dog CANX in canine cell lines

    • Induce ER stress using pharmacological agents (tunicamycin, thapsigargin)

    • Monitor changes in CANX expression, localization, and interaction partners

    • Compare responses between normal and disease-relevant cellular contexts

  • Stress response evaluation:

    • Similar to the approach used with TrCNX1 in E. coli , express dog CANX in model systems

    • Expose to stress conditions relevant to canine diseases

    • Measure survival rates and cellular responses

    • Evaluate protective effects against specific stressors

  • Biomarker development:

    • Quantify CANX levels in canine samples using ELISA methods

    • Correlate CANX expression with disease progression or severity

    • Develop diagnostic approaches based on CANX levels or modifications

  • Therapeutic target exploration:

    • Screen for compounds that modulate CANX function

    • Test interventions that enhance or inhibit CANX chaperone activity

    • Evaluate effects on ER stress responses and disease phenotypes

The availability of recombinant dog CANX and detection methods like the CANX ELISA kit facilitates these investigations, potentially leading to new insights into canine ER stress-related diseases.

What strategies can overcome common challenges in expressing and purifying full-length recombinant dog CANX?

Full-length recombinant dog CANX expression presents several technical challenges that can be addressed with specific strategies:

Challenge 1: Protein solubility issues

  • Solutions:

    • Optimize induction conditions (temperature, IPTG concentration, duration)

    • Express at lower temperatures (16-25°C) to promote proper folding

    • Include solubility-enhancing tags (e.g., His-tag as used successfully)

    • Add solubility enhancers like trehalose to buffer systems

Challenge 2: Protein degradation during purification

  • Solutions:

    • Include protease inhibitors during all purification steps

    • Perform purification at 4°C to minimize degradation

    • Use optimized buffer compositions (e.g., Tris/PBS-based buffer with 6% trehalose at pH 8.0)

    • Aliquot and store properly to prevent repeated freeze-thaw cycles

Challenge 3: Low expression yields

  • Solutions:

    • Optimize codon usage for E. coli expression

    • Test different E. coli strains (BL21(DE3) has proven effective)

    • Adjust induction timing and conditions (100 μM IPTG for 1 hour has worked)

    • Consider using specialized expression strains designed for membrane-associated proteins

Challenge 4: Maintaining native conformation

  • Solutions:

    • Reconstitute lyophilized protein carefully according to recommendations

    • Add 5-50% glycerol to stabilize protein structure during storage

    • Store working aliquots at 4°C for up to one week to maintain activity

    • For long-term storage, maintain at -20°C/-80°C in appropriate buffer

How can researchers validate the functional integrity of recombinant dog CANX for experimental use?

Validating the functional integrity of recombinant dog CANX requires multiple complementary approaches:

Structural validation:

  • SDS-PAGE analysis:

    • Confirm protein purity (>90% is typically acceptable)

    • Verify the expected molecular weight (~75 kDa for His-tagged full-length dog CANX)

  • Western blot confirmation:

    • Use anti-CANX antibodies to verify protein identity

    • Recommended antibody dilution: 1/1000

    • Compare with positive and negative controls (e.g., calnexin-deficient human samples)

Functional validation:

  • Chaperone activity assays:

    • Test ability to assist in protein folding using model substrates

    • Measure prevention of protein aggregation under stress conditions

  • Stress protection assessment:

    • Express recombinant CANX in a heterologous system (e.g., E. coli)

    • Subject to stress conditions (e.g., UV-B or gamma irradiation)

    • Compare viability against control cells to demonstrate protective function

  • Binding assays:

    • Verify calcium-binding capability through appropriate assays

    • Test interaction with known CANX client proteins using co-immunoprecipitation

These validation steps ensure that the recombinant dog CANX maintains both structural integrity and functional activity for reliable experimental use.

What experimental design considerations are critical when comparing data between recombinant dog CANX and native canine CANX?

When comparing recombinant and native dog CANX, several experimental design considerations are essential:

Key experimental variables to control:

VariableConsiderationsRecommendations
Expression systemDifferent systems introduce varying PTMsDocument expression system used (e.g., E. coli)
Protein tagsMay affect function or interactionsAccount for tag effects in analysis (e.g., His-tag)
Buffer conditionsInfluence protein stability and activityStandardize buffers across experiments
Storage historyAffects protein integrityDocument freeze-thaw cycles and storage conditions
Detection methodsVary in sensitivity and specificityUse consistent methods with appropriate controls

Recommended experimental design elements:

  • Direct comparisons:

    • Run native and recombinant CANX side-by-side in functional assays

    • Use identical buffer conditions and experimental parameters

    • Include appropriate positive and negative controls

  • Structural analysis:

    • Compare post-translational modifications between recombinant and native forms

    • Assess differences in folding or oligomerization states

    • Consider the impact of expression system on protein structure

  • Statistical considerations:

    • Perform multiple biological replicates (minimum n=3)

    • Use appropriate statistical tests to evaluate significance of differences

    • Report variability metrics (standard deviation, standard error)

  • Documentation:

    • Clearly report all relevant experimental details

    • Document protein concentrations, purity assessments, and storage conditions

    • Specify the exact form of CANX used in each experiment (e.g., full-length vs. truncated)

By carefully controlling these variables and thoroughly documenting experimental conditions, researchers can make valid comparisons between recombinant and native dog CANX.

How might recombinant dog CANX be utilized in comparative studies of ER stress responses across species?

Recombinant dog CANX offers unique opportunities for cross-species comparisons of ER stress responses:

Comparative analysis approaches:

  • Sequence and structure comparisons:

    • Align dog CANX with homologs from other species (human, mouse, etc.)

    • Identify conserved functional domains and species-specific variations

    • Dog CANX shows significant homology with calnexin from other plants and animals

  • Functional conservation assessment:

    • Express recombinant dog CANX in heterologous systems from different species

    • Compare protective effects against various stressors across species

    • Evaluate species-specific differences in binding partners and client proteins

  • Cross-species stress response studies:

    • Subject different species' cells expressing their native CANX or recombinant dog CANX to identical stressors

    • Compare ER stress responses, unfolded protein response activation, and cell survival

    • Identify species-specific adaptations in CANX-mediated stress responses

These comparative approaches can reveal evolutionary adaptations in ER quality control mechanisms and identify conserved therapeutic targets for ER stress-related diseases across species.

What role might recombinant dog CANX play in developing biomarkers for canine ER stress-related diseases?

Recombinant dog CANX has significant potential for biomarker development in canine diseases:

Biomarker development strategies:

  • Reference standard development:

    • Use purified recombinant dog CANX as a calibration standard for quantitative assays

    • Develop and validate sensitive detection methods like the Dog Calnexin ELISA Kit

    • Establish normal reference ranges in healthy canine populations

  • Disease correlation studies:

    • Measure CANX levels in samples from dogs with suspected ER stress-related diseases

    • Correlate CANX expression or modification patterns with disease severity

    • Identify disease-specific alterations in CANX that could serve as diagnostic markers

  • Therapeutic monitoring:

    • Track changes in CANX levels or modifications during treatment

    • Evaluate CANX as a marker of treatment response

    • Assess normalization of ER stress using CANX-based measurements

  • Companion diagnostics:

    • Develop CANX-based assays to identify dogs likely to respond to specific therapies

    • Create point-of-care tests based on CANX detection for clinical settings

    • Incorporate CANX biomarkers into multiparameter diagnostic panels

The availability of detection methods like the CANX ELISA kit that can measure calnexin in serum, plasma, and cell culture supernatants facilitates these biomarker development efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.