Recombinant Dog CD166 antigen (ALCAM)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. We recommend consulting your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs by default. For dry ice shipment, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing should be avoided. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
ALCAM; CD166 antigen; Activated leukocyte cell adhesion molecule; SB-10 antigen; CD antigen CD166; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-521
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
GSPVFIAFRSSTKKSVQYDDVPEYEDRLSLSENYTLSISNARISDEKRFVCMLVTEDNVF EAPTIVKVFKQPSKPEIVSKAPFLETEQLKKLGDCISKDSYPDGNITWYRNGKVLQPLEG VVVLIFKKQMDPVTQLYTMTSSLEYKATKADIQMQFTCSVTYYGPSGQKTVQSEQAIFDI YYPTEQVTIQVLPSKTAIKEGDIITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTD VRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTKQIGDALPVSCTISASRNA TVVWMKDNIRLRSSPSFSSLQYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTK KTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSTIINSPEENVT LTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREQVNHRATLIVGIVLRLLHGALV AGVVYWLYVKKSKTASKHVNKDLGNLEENKKLEQNNHRTEA
Uniprot No.

Target Background

Function
CD166, also known as ALCAM (Activated Leukocyte Cell Adhesion Molecule), is a cell adhesion molecule involved in mediating both heterotypic and homotypic cell-cell interactions. It interacts with CD6 to facilitate heterotypic interactions, contributing to T-cell activation and proliferation, as well as the formation and maturation of the immunological synapse. ALCAM also mediates homotypic interactions with other ALCAM-expressing cells, playing a role in various cellular processes:
  • Lymphatic system: Contributes to the organization of the lymph vessel network.
  • Hematopoiesis: Essential for normal hematopoietic stem cell engraftment in the bone marrow and normal hematopoietic stem cell numbers.
  • Bone development: Promotes osteoblast proliferation and differentiation.
  • Nervous system: Facilitates neurite extension, axon growth, and axon guidance, promoting axonal growth on surfaces containing ALCAM.
  • Retinal development: Mediates outgrowth and pathfinding for retinal ganglion cell axons.
Furthermore, ALCAM's homotypic interactions with endothelial cells influence their migration and tube formation.
Database Links
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.

Q&A

What is the molecular structure of canine CD166/ALCAM and how does it compare to human variants?

Canine CD166/ALCAM is a transmembrane glycoprotein belonging to the immunoglobulin superfamily, spanning approximately Trp28-Lys527 in its amino acid sequence . The protein exhibits high structural homology with human ALCAM/CD166, containing five immunoglobulin-like domains: two membrane-distal variable (V)-type domains and three membrane-proximal constant (C2)-type domains. The molecular weight of canine CD166/ALCAM typically appears as 90-120 kDa in western blot analysis under reducing conditions, which is consistent with its heavily glycosylated nature . Sequence alignment analysis demonstrates approximately 93% amino acid identity between canine and human ALCAM/CD166, making it valuable for translational research and comparative oncology studies.

What are the primary cellular distributions and functions of CD166/ALCAM in canine tissues?

CD166/ALCAM in canine tissues demonstrates expression across multiple cell types with varying intensity. Flow cytometry analysis confirms expression in activated canine peripheral blood mononuclear cells (PBMCs), particularly following stimulation with PMA and Calcium Ionomycin . Immunohistochemical studies have revealed CD166/ALCAM localization in:

  • Liver hepatocytes and bile duct epithelia

  • Activated leukocytes, particularly T cells

  • Neural tissues

  • Epithelial cells across multiple organ systems

  • Mesenchymal stem cells, where it serves as a potential marker

Functionally, canine CD166/ALCAM mediates both homophilic (CD166-CD166) and heterophilic (CD166-CD6) cell-cell interactions that regulate immune responses, cell migration, and tissue organization. It plays crucial roles in:

  • Leukocyte activation and trafficking

  • Tissue development and regeneration

  • Cellular adhesion in normal and pathological states

  • Cancer cell invasion and metastasis

How is CD166/ALCAM expression regulated in canine cells under normal physiological conditions?

CD166/ALCAM expression in canine cells demonstrates dynamic regulation influenced by multiple pathways. In normal canine PBMCs, expression is significantly upregulated following activation with PMA and Calcium Ionomycin, suggesting regulation through protein kinase C (PKC) and calcium-dependent signaling pathways . Flow cytometry analyses reveal that resting canine immune cells exhibit lower baseline expression compared to activated populations, pointing to an activation-dependent regulatory mechanism .

Tissue-specific regulation also occurs, with immunohistochemical studies showing differential expression patterns across canine tissues. For example, in liver tissues, CD166/ALCAM demonstrates constitutive expression, while in immune cells, expression is more tightly regulated and activation-dependent . This differential regulation suggests the involvement of tissue-specific transcription factors and epigenetic mechanisms. Research indicates that inflammatory cytokines, growth factors, and cellular stress can modulate CD166/ALCAM expression, though the precise molecular mechanisms in canines require further characterization.

What are the optimal methods for detecting and quantifying CD166/ALCAM expression in canine tissue samples?

Multiple validated techniques are available for detecting and quantifying CD166/ALCAM in canine samples, each with specific advantages for different research questions:

TechniqueSample TypeKey ReagentsSensitivityApplicationsNotes
Western BlotTissue lysates, Cell linesAnti-CD166 antibody (AF1172) ModerateProtein size verification, Semi-quantitative analysisUse PVDF membrane with 0.2 μg/mL antibody concentration for optimal results
Flow CytometryPBMCs, Cell suspensionsAnti-CD166 antibody with fluorochrome conjugate HighQuantitative cellular expression, Population analysisEffective for activated PBMCs with PMA/Ionomycin treatment
Immunohistochemistry/ ImmunofluorescenceFFPE sections, Frozen sectionsAnti-CD166 antibody (1.7-10 μg/mL) Moderate-HighSpatial localization, Tissue distributionOptimize fixation protocols for epitope preservation
Simple Western™Tissue lysatesAnti-CD166 antibody (12.5 μg/mL) HighAutomated quantificationEffective using 12-230 kDa separation system
CEI (Capillary Immunoelectrophoresis)Biopsy samplesAnti-idiotypic antibody HighActivated form detectionUseful for monitoring in vivo activation states

For immunohistochemical detection in canine tissues, counterstaining with DAPI and using NorthernLights™ 557-conjugated secondary antibodies (NL001) has shown excellent results at concentrations of 1.7 μg/mL for liver tissues and 10 μg/mL for mesenchymal stem cells . For flow cytometry, comparing to isotype controls (e.g., AB-108-C) is essential for accurate gating and quantification .

What are the critical factors for successful expression and purification of recombinant canine CD166/ALCAM?

Successful expression and purification of recombinant canine CD166/ALCAM requires careful consideration of several critical factors:

  • Expression System Selection:

    • Mammalian expression systems (particularly CHO or HEK293 cells) are preferred over bacterial systems due to the need for proper glycosylation and disulfide bond formation

    • Insect cell systems (Sf9, High Five) offer a compromise between proper folding and higher yields

  • Construct Design:

    • Include the mature extracellular domain (Trp28-Lys527) for soluble protein production

    • Consider adding a cleavable signal peptide for secretion

    • C-terminal tags (His6, Fc) provide purification handles with minimal interference with function

    • For membrane-bound versions, include the transmembrane domain and potentially a truncated cytoplasmic tail

  • Purification Strategy:

    • Two-step purification typically yields higher purity: affinity chromatography followed by size exclusion

    • For His-tagged constructs, use immobilized metal affinity chromatography with gradual imidazole elution

    • Monitor protein quality by SDS-PAGE under both reducing and non-reducing conditions to assess disulfide bond formation

  • Quality Control Metrics:

    • Confirm identity through western blot with validated anti-CD166 antibodies (AF1172)

    • Assess biological activity through cell adhesion assays or binding to known ligands (CD6)

    • Verify glycosylation status through glycosidase treatment and mobility shift assays

    • Test thermal stability using differential scanning fluorimetry

  • Storage Conditions:

    • Optimal stability achieved at -70°C in PBS with 10% glycerol

    • Avoid repeated freeze-thaw cycles that significantly reduce activity

    • For routine use, store reconstituted protein at 2-8°C for up to 1 month under sterile conditions

How can researchers establish valid in vitro models for studying canine CD166/ALCAM functionality?

Researchers can establish several complementary in vitro models to study canine CD166/ALCAM functionality:

  • Cell Line Models:

    • Canine tumor cell lines with endogenous CD166/ALCAM expression provide physiologically relevant systems

    • U-118-MG glioblastoma lines shown to express detectable levels of CD166/ALCAM can serve as positive controls for human comparative studies

    • Transfected cell lines with inducible or constitutive expression systems allow controlled expression levels for dose-response studies

  • Primary Cell Cultures:

    • Isolated canine PBMCs treated with PMA/Ionomycin demonstrate activation-dependent expression

    • Canine mesenchymal stem cells show constitutive expression and can be used for differentiation studies

    • Co-culture systems with CD6-expressing cells allow for heterophilic interaction studies

  • Organoid Models:

    • Canine-derived organoids from tissues like apocrine gland anal sac adenocarcinoma (AGASACA) provide three-dimensional tissue architecture

    • Organoids maintain tissue-specific expression patterns and can reproduce the original tumor's histopathological characteristics

    • These models allow for drug sensitivity profiling with compounds targeting CD166/ALCAM

  • Functional Assays:

    • Adhesion assays using recombinant CD166/ALCAM-coated plates to measure cellular binding

    • Migration/invasion assays to assess the role of CD166/ALCAM in cell motility

    • Antibody blocking studies to evaluate functional dependence on CD166/ALCAM

  • Validation Approaches:

    • CRISPR/Cas9-mediated knockout or knockdown models to confirm specificity

    • Rescue experiments with wild-type versus mutant CD166/ALCAM to map functional domains

    • Comparative studies with human cells to assess translational relevance

For organoid models specifically, protocols established for canine AGASACA can be adapted for CD166/ALCAM functional studies, with successful generation rates approaching 100% from surgically removed tissues .

How is CD166/ALCAM being utilized as a therapeutic target in canine cancer models, and what are the implications for comparative oncology?

CD166/ALCAM has emerged as a promising therapeutic target in both human and canine cancer models, with several approaches being explored:

  • Antibody-Drug Conjugates (ADCs):
    The development of praluzatamab ravtansine (CX-2009), a CD166-targeting ADC with a protease-cleavable linker and DM4 payload, demonstrates the feasibility of targeting CD166 in tumors . Although initially developed for human applications, the high homology between canine and human CD166 (>90%) suggests potential cross-reactivity and application in veterinary oncology. In human studies, this approach has shown:

    • Confirmed partial responses in 9% of hormone receptor-positive/HER2-negative breast cancer patients

    • Stable disease in 45% of the same patient subset

    • Tumor regressions at doses ≥4 mg/kg

    The "Probody" technology used in CX-2009, which masks the antibody binding site until activated by tumor-associated proteases, addresses the challenge of CD166's widespread expression in normal tissues . This approach could be particularly valuable for canine patients, where similar concerns about on-target, off-tumor toxicity exist.

  • Emerging Targets in Canine Tumors:
    CD166/ALCAM expression correlates with several prognostic indicators in canine tumors, similar to human cancers. In canine AGASACA models, CD166/ALCAM is co-expressed with other markers including:

    • CK7 (positive)

    • HER2 (positive in 80% of cases)

    • p53 (nuclear accumulation)

    • p63 (overexpression)

    • VEGF (positive)

    • Ki67 (increased expression)

    This expression profile creates opportunities for combination therapies targeting multiple pathways simultaneously in canine cancer models.

  • Comparative Oncology Applications:
    Canine CD166/ALCAM-positive tumors serve as valuable spontaneous models for human cancer research. The AGASACA organoid models maintain the histopathological, genetic, and phenotypic characteristics of patient-derived tumor tissues and can reproduce tumor microenvironments through co-culture systems . These models have demonstrated:

    • Different sensitivity profiles to carboplatin, mitoxantrone, toceranib, and lapatinib among lineages

    • Tumorigenicity when implanted in immunodeficient mice

    • Retention of diagnostic markers from original tumors

    These features make canine CD166/ALCAM research directly relevant to human therapeutic development, particularly for rare human apocrine gland carcinomas where few validated experimental models exist.

What role does CD166/ALCAM play in canine immune responses and how can this be leveraged in immunotherapy research?

CD166/ALCAM plays multifaceted roles in canine immune regulation through both structural mechanisms and signaling pathways:

  • Immune Cell Activation and Differentiation:

    • Flow cytometry analysis confirms upregulation of CD166/ALCAM in activated canine PBMCs following PMA/Ionomycin stimulation, indicating its role in T cell activation cascades

    • The expression pattern differs between resting and activated lymphocyte populations, suggesting a regulated role in immune response progression

    • CD166/ALCAM's interaction with CD6 on T cells contributes to immunological synapse formation and sustained T cell activation

  • Tumor-Immune Interactions:

    • CD166/ALCAM expression on canine tumor cells may facilitate interactions with CD6-expressing T cells, potentially modulating anti-tumor immunity

    • In human studies, CD166/ALCAM-positive tumors show distinct patterns of immune infiltration, which likely extends to canine models

    • The role of CD166/ALCAM in immune checkpoint regulation remains an active area of investigation

  • Immunotherapy Applications:

    • Bispecific antibodies targeting CD166/ALCAM on tumor cells and engaging T cells represent a promising approach

    • Modified CAR-T cell therapies using CD166/ALCAM as a target antigen, particularly with controlled activation mechanisms

    • Probody™ technology demonstrated with CX-2009 could be applied to immunomodulatory antibodies targeting the CD166/ALCAM pathway

  • Emerging Research Directions:

    • Investigation of CD166/ALCAM's role in tumor microenvironment remodeling and immune exclusion

    • Exploration of CD166/ALCAM as a biomarker for immunotherapy response in canine patients

    • Development of combination approaches targeting both CD166/ALCAM and established immune checkpoints

Recent unpublished data suggests that CD166/ALCAM expression levels may correlate with immune infiltration patterns in canine tumors, similar to observations in human cancers. This connection provides rationale for exploring CD166/ALCAM-targeted therapies in combination with immune checkpoint inhibitors in veterinary clinical trials.

How can researchers effectively monitor CD166/ALCAM targeting in vivo in canine models?

Monitoring CD166/ALCAM targeting in vivo in canine models requires sophisticated approaches that balance sensitivity, specificity, and practical feasibility:

  • Molecular Imaging Techniques:

    • Zirconium-89 labeled antibodies ([89Zr]Zr-CX-2009) have successfully demonstrated tumor-specific uptake while confirming shielding of major organs expressing CD166 in human studies

    • This approach can be adapted for canine studies using species-specific or cross-reactive CD166/ALCAM antibodies

    • PET/CT imaging provides quantitative assessment of biodistribution and tumor penetration over time

    • The optimal imaging timepoint is typically 4-7 days post-injection due to the extended circulation time of antibody-based tracers

  • Tissue-Based Monitoring:

    • On-treatment biopsies collected at defined timepoints (e.g., day 4 after treatment initiation) can assess activated CD166/ALCAM-targeted therapeutics in tumor tissue

    • Capillary immunoelectrophoresis (CEI) assays using anti-idiotypic antibodies can quantify activated therapeutic levels in tumor samples

    • These approaches have demonstrated correlation between intratumoral CD166 levels and activated therapeutic in human studies

    • IHC assessment of downstream effects, such as apoptosis markers or payload-induced DNA damage

  • Liquid Biopsy Approaches:

    • Circulating tumor cells (CTCs) expressing CD166/ALCAM can be isolated and analyzed for therapeutic binding

    • Plasma pharmacokinetic analysis can monitor the ratio of intact/masked versus activated forms of Probody-based therapeutics

    • Circulating tumor DNA (ctDNA) analysis can monitor treatment response in CD166/ALCAM-targeted approaches

  • Functional Monitoring:

    • Sequential fine-needle aspirates for ex vivo functional assays

    • Real-time monitoring of tumor metabolism using approaches like 18F-FDG PET imaging

    • Multiplex cytokine analysis to assess immune activation in response to CD166/ALCAM-targeted immunotherapies

The ideal monitoring strategy combines multiple approaches, with molecular imaging providing whole-body distribution information and tissue sampling offering detailed mechanistic insights. For masked therapeutics like CX-2009, the ability to distinguish between inactive circulating forms (>90% of total in plasma) and activated tumor-localized forms is particularly important .

What are the key structural and functional differences between canine CD166/ALCAM and its orthologs in humans, mice, and other research-relevant species?

CD166/ALCAM demonstrates high conservation across mammalian species, but with notable differences that can impact research translation:

SpeciesSequence Homology to CanineMolecular WeightKey Structural DifferencesFunctional ImplicationsCross-Reactivity with Antibodies
Canine100%90-120 kDa ReferenceReferenceAF1172
Human~93%100-105 kDaMinor differences in glycosylation patterns; Conserved immunoglobulin domainsSimilar cell adhesion properties; Comparable roles in cancer progressionMost canine-reactive antibodies cross-react
Mouse~87%90-120 kDa More variable glycosylation; Differences in N-terminal domainDifferential binding affinity to CD6; Similar roles in neural developmentAF1172 shows confirmed cross-reactivity
Rat~85%90-120 kDa Similar to mouseSimilar tissue distribution patternsAF1172 shows confirmed cross-reactivity
Non-human primates>95%100-105 kDaHighly similar to humanNearly identical functionalityStrong cross-reactivity with human reagents

Western blot analysis using the AF1172 antibody has confirmed recognition of CD166/ALCAM across multiple species, with bands detected at similar molecular weights in mouse brain, rat brain, rat hepatoma cells, and human glioblastoma cells . This cross-reactivity facilitates comparative studies but requires careful interpretation of results when subtle species differences may impact function.

Functionally, all mammalian CD166/ALCAM orthologs mediate both homophilic (CD166-CD166) and heterophilic (CD166-CD6) interactions, but with varying binding affinities. The N-terminal V-type immunoglobulin domains, which mediate these interactions, show the highest variability across species, potentially affecting binding kinetics and downstream signaling.

How does CD166/ALCAM expression and function differ across various canine breeds and disease states?

CD166/ALCAM expression and function exhibit notable variations across canine breeds and disease states, reflecting genetic diversity and pathophysiological adaptations:

Current research gaps include comprehensive mapping of CD166/ALCAM expression across diverse canine breeds in both healthy and diseased states. Such data would enhance our understanding of CD166/ALCAM's role in breed-specific disease predispositions and inform more personalized therapeutic approaches in veterinary medicine.

How do experimental results with recombinant canine CD166/ALCAM translate to clinical applications in both veterinary and human medicine?

Translating experimental findings with recombinant canine CD166/ALCAM to clinical applications involves multiple considerations across the basic-to-clinical research spectrum:

  • Veterinary Clinical Applications:

    • Diagnostic Biomarker Development: CD166/ALCAM expression analysis in tumor biopsies can aid in diagnosis and prognostication of canine malignancies

    • Therapeutic Target Validation: Preclinical studies with recombinant CD166/ALCAM have identified it as a tractable target, particularly for antibody-drug conjugate approaches

    • Patient Selection: IHC assays measuring CD166/ALCAM expression levels may help identify canine patients most likely to respond to targeted therapies

    • Therapeutic Monitoring: Serial measurement of soluble CD166/ALCAM in serum could potentially track treatment response

  • Comparative Oncology Benefits:

    • Spontaneous Disease Models: Canine tumors expressing CD166/ALCAM represent naturally occurring models of human disease with intact immune systems

    • Accelerated Drug Development: Trials in companion animals with spontaneous tumors can provide valuable efficacy and safety data that complement traditional preclinical models

    • Shared Environmental Exposures: Dogs share human living environments, making them excellent sentinels for environmental carcinogenesis

  • Human Medicine Translation:

    • Target Validation: High homology between canine and human CD166/ALCAM supports the relevance of canine findings to human medicine

    • Therapeutic Agents: Antibody-drug conjugates like praluzatamab ravtansine (CX-2009) developed against human CD166 demonstrate clinical activity in human trials

    • Rare Cancer Insights: Canine AGASACA serves as a model for rare human apocrine gland carcinomas where few experimental models exist

  • Translational Research Examples:

    • Organoid cultures from canine AGASACA have demonstrated different sensitivity profiles to targeted therapies including lapatinib and toceranib

    • These findings inform both veterinary treatment protocols and provide insights into potential therapeutic approaches for rare human cancers

    • The Probody platform demonstrated with CX-2009 achieves >90% masking in circulation while allowing tumor-specific activation, addressing safety concerns with targeting widely expressed antigens like CD166/ALCAM

  • Clinical Trial Design Considerations:

    • Incorporation of validated biomarker assays for CD166/ALCAM expression

    • Stratification based on expression levels to identify potential responder populations

    • Collection of paired biopsies for mechanism-of-action studies

    • Integration of molecular imaging to confirm target engagement

The bidirectional flow of information between canine and human CD166/ALCAM research exemplifies the "One Health" approach, where discoveries in veterinary medicine inform human clinical development and vice versa.

What are common technical challenges when working with recombinant canine CD166/ALCAM, and how can researchers address them?

Researchers working with recombinant canine CD166/ALCAM frequently encounter several technical challenges that can affect experimental outcomes:

  • Protein Aggregation Issues:

    • Challenge: Recombinant CD166/ALCAM can form aggregates during expression, purification, or storage

    • Solution: Add 0.05-0.1% non-ionic detergents (e.g., Tween-20) during purification; use size exclusion chromatography as a final purification step; store at optimal concentrations (0.5-1 mg/mL); avoid repeated freeze-thaw cycles

    • Validation: Perform dynamic light scattering or analytical ultracentrifugation to confirm monodispersity

  • Inconsistent Glycosylation Patterns:

    • Challenge: Variable glycosylation affecting mobility on gels (90-120 kDa range) and potentially function

    • Solution: Use mammalian expression systems (CHO, HEK293) with consistent culture conditions; consider enzymatic deglycosylation for applications where glycosylation may interfere

    • Validation: Compare mobility with and without PNGase F treatment to assess glycosylation contribution

  • Epitope Masking During Fixation:

    • Challenge: Common fixatives may mask CD166/ALCAM epitopes in IHC/ICC applications

    • Solution: For frozen sections, optimal results achieved with 1.7 μg/mL antibody concentration; for cell lines, 10 μg/mL shows better detection; optimize fixation protocols (4% PFA for shorter durations, 10-15 minutes)

    • Validation: Compare different fixation protocols side-by-side with positive control tissues

  • Non-specific Binding in Detection Assays:

    • Challenge: High background in flow cytometry or immunostaining

    • Solution: Include proper blocking (5-10% serum from secondary antibody species); use isotype controls (e.g., AB-108-C) for setting gates in flow cytometry; titrate primary antibody concentrations

    • Validation: Always include isotype controls and secondary-only controls

  • Stability During Storage:

    • Challenge: Activity loss during storage

    • Solution: For long-term storage, maintain at -70°C; for reconstituted protein, store at 2-8°C for up to 1 month under sterile conditions; for extended storage (up to 6 months), store at -20 to -70°C

    • Validation: Test activity of stored samples against freshly prepared standards periodically

  • Inconsistent Activation in Probody Applications:

    • Challenge: Variable activation of masked antibodies in different tumor microenvironments

    • Solution: Optimize protease-cleavable linker design; characterize protease expression in target tissues; monitor activated versus masked forms using capillary immunoelectrophoresis

    • Validation: Confirm presence of activated forms in tumor biopsies post-treatment

These challenges can be systematically addressed through careful optimization and validation protocols, ensuring reproducible results across experiments.

How should researchers interpret discrepancies between in vitro and in vivo findings with CD166/ALCAM in canine models?

Discrepancies between in vitro and in vivo findings with CD166/ALCAM in canine models are common and require careful interpretation:

  • Expression Level Discrepancies:

    • Observation: Cell lines may show different CD166/ALCAM expression levels than corresponding tissues in vivo

    • Interpretation: Cell culture conditions (2D vs. 3D, media composition, cell density) significantly influence CD166/ALCAM expression levels

    • Resolution Approach: Use organoid models that better preserve tissue architecture and expression patterns ; validate findings across multiple cell lines; confirm with fresh tissue samples

  • Functional Role Discrepancies:

    • Observation: CD166/ALCAM knockdown may show dramatic effects in vitro but more subtle phenotypes in vivo

    • Interpretation: Compensatory mechanisms and redundant adhesion pathways may mitigate effects in complex in vivo environments

    • Resolution Approach: Use conditional and inducible knockout models; examine acute versus chronic effects; assess compensation by related adhesion molecules

  • Therapeutic Response Differences:

    • Observation: CD166/ALCAM-targeted therapies may show different efficacy profiles between cell culture and animal models

    • Interpretation: Factors including tumor microenvironment, immune components, and pharmacokinetics significantly impact in vivo responses

    • Resolution Approach: Use diverse models including organoids and patient-derived xenografts; measure intratumoral drug concentration; assess activated versus masked therapeutic forms in tumor samples

  • Binding Affinity Variations:

    • Observation: Recombinant CD166/ALCAM may show different binding characteristics than native protein

    • Interpretation: Post-translational modifications, particularly glycosylation patterns, significantly affect binding properties

    • Resolution Approach: Compare binding properties across expression systems; use cell-based binding assays; validate with primary cells and tissues

  • Clinical Translation Challenges:

    • Observation: Promising preclinical findings may not translate to clinical veterinary settings

    • Interpretation: Heterogeneity across patients, breeds, and disease stages contributes to variable responses

    • Resolution Approach: Develop predictive biomarker assays; stratify patients based on CD166/ALCAM expression levels; incorporate pharmacodynamic endpoints in early clinical studies

The validated organoid models for canine AGASACA provide an intermediate system between traditional cell lines and in vivo models, maintaining key aspects of tissue architecture while allowing controlled experimental manipulation . These models have demonstrated the ability to predict differential therapeutic responses to several compounds, suggesting their utility in bridging in vitro-in vivo discrepancies .

What are the most important considerations when designing CD166/ALCAM targeting strategies for canine diseases?

When designing CD166/ALCAM targeting strategies for canine diseases, researchers should address several critical considerations to maximize safety and efficacy:

  • Target Expression Profile Analysis:

    • Challenge: CD166/ALCAM is expressed in both normal and diseased tissues

    • Approach: Comprehensive mapping of expression across healthy canine tissues using validated IHC protocols

    • Implementation: Develop a "therapeutic window" based on expression differential between target (e.g., tumor) and normal tissues

    • Example Solution: Probody technology demonstrated with CX-2009 addresses this challenge by masking the binding site until activated by tumor-associated proteases

  • Species-Specific Targeting:

    • Challenge: Despite high homology, species-specific differences may affect binding and function

    • Approach: Develop and validate canine-specific or cross-reactive targeting agents

    • Implementation: Test cross-reactivity of existing reagents (e.g., AF1172 antibody has confirmed cross-reactivity) ; optimize binding to canine-specific epitopes

    • Example Solution: Species-specific antibody development or careful validation of cross-reactive agents across relevant functional assays

  • Therapeutic Payload Selection:

    • Challenge: Different disease contexts require specific mechanisms of action

    • Approach: Match payload mechanism to disease biology

    • Implementation: For cancer applications, consider both highly potent cytotoxics (e.g., DM4 as used in CX-2009) and immunomodulatory payloads

    • Example Solution: Drug sensitivity testing in organoid models to identify optimal payloads, as demonstrated with canine AGASACA organoids showing differential sensitivity to carboplatin, mitoxantrone, toceranib, and lapatinib

  • Delivery System Design:

    • Challenge: Achieving sufficient target engagement while minimizing off-target effects

    • Approach: Optimize linker chemistry, masking strategies, and dosing schedules

    • Implementation: For antibody-drug conjugates, consider protease-cleavable linkers activated in disease microenvironments ; evaluate pharmacokinetics and biodistribution

    • Example Solution: The CX-2009 design incorporates a protease-cleavable linker and mask that limits target engagement in normal tissue

  • Patient Selection Strategy:

    • Challenge: Identifying patients most likely to benefit from CD166/ALCAM-targeted approaches

    • Approach: Develop predictive biomarker assays for veterinary clinical application

    • Implementation: IHC assays with validated scoring systems (e.g., H-score methodology) ; correlation of expression with clinical outcomes

    • Example Solution: In human studies, correlation of intratumoral CD166 levels with activated CX-2009 in biopsies suggests the potential for expression-based patient selection

  • Monitoring Plan Development:

    • Challenge: Assessing target engagement and therapeutic response

    • Approach: Multi-modal monitoring incorporating molecular imaging and tissue analysis

    • Implementation: Adapt approaches from human studies, such as zirconium-labeled antibodies for PET imaging ; develop practical monitoring protocols suitable for veterinary settings

    • Example Solution: Collection of pre- and on-treatment biopsies for direct assessment of target engagement and pharmacodynamic effects

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.