Recombinant Dog CD40 ligand (CD40LG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please specify your preference in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on your purchasing method and location. Please contact your local distributor for specific delivery timelines.
Note: All protein shipments are standardly sent with blue ice packs. Should you require dry ice, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Please reconstitute the protein with deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please let us know, and we will prioritize its development.
Synonyms
CD40LG; CD40L; TNFSF5; CD40 ligand; CD40-L; Tumor necrosis factor ligand superfamily member 5; CD antigen CD154
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-260
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MIETYSQTAPRSVATGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLYEDFVFMKTLQKCNKGEGSLSLLNCEEIKSQFEAFLKEIMLNNEMKKEENIAMQKGDQDPRIAAHVISEASSNPASVLRWAPKGYYTISSNLVSLENGKQLAVKRQGLYYVYAQVTFCSNRAASSQAPFVASLCLHSPSGTERVLLRAASSRGSSKPCGQQSIHLGGVFELHPGASVFVNVTDPSQVSHGTGFTSFGLLKL
Uniprot No.

Target Background

Function
CD40 ligand (CD40LG) is a cytokine that acts as a ligand for CD40/TNFRSF5. It serves as a costimulator for T-cell proliferation and cytokine production. Cross-linking of CD40LG on T-cells triggers a costimulatory signal that, in conjunction with TCR/CD3 ligation and CD28 costimulation, enhances the production of IL4 and IL10. It also activates NF-kappa-B. In T-cells, CD40LG induces the activation of kinases MAPK8 and PAK2. In the absence of co-stimulus, CD40LG mediates B-cell proliferation, and in the presence of IL4, it induces IgE production. CD40LG is involved in immunoglobulin class switching. It also acts as a ligand for integrins, specifically ITGA5:ITGB1 and ITGAV:ITGB3. Both integrins and the CD40 receptor are essential for the activation of CD40-CD40LG signaling, leading to cell-type specific effects, including B-cell activation, NF-kappa-B signaling, and anti-apoptotic signaling.
Database Links

KEGG: cfa:403468

STRING: 9615.ENSCAFP00000027967

UniGene: Cfa.179

Protein Families
Tumor necrosis factor family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell surface.; [CD40 ligand, soluble form]: Secreted.

Q&A

What is canine CD40 ligand and what are its primary functions in the immune system?

Canine CD40 ligand (CD40L, also known as CD154) is a member of the tumor necrosis factor (TNF) family that plays essential roles in immune system regulation. It is primarily expressed on activated T cells and interacts with CD40 receptors found on B cells, dendritic cells, macrophages, and endothelial cells.

The primary functions of CD40L include:

  • Mediating T cell-dependent immunoglobulin class switching

  • Supporting memory B cell development

  • Facilitating germinal center formation

  • Activating antigen-presenting cells

  • Stimulating inflammatory responses

Studies have shown that the CD40-CD40L interaction is crucial for various immune responses, making it a significant target for immunotherapeutic approaches in canine disease models .

How does canine CD40L compare structurally and functionally to human CD40L?

While canine and human CD40L share significant structural and functional homology, there are species-specific differences that researchers should consider:

  • Sequence homology: Canine and human CD40L share approximately 80% amino acid identity in their extracellular domains

  • Cross-reactivity: Human CD40L can bind to canine CD40, though with potentially reduced affinity compared to species-matched interactions

  • Functional conservation: Both canine and human CD40L can activate B cells, induce dendritic cell maturation, and stimulate immune responses

Research has demonstrated that while human anti-CD154 antibodies (like 5c8) can cross-react with canine cells, species-specific reagents like canine CD40-Ig fusion proteins show greater efficacy in canine experimental systems. In mixed leukocyte reactions, canine CD40-Ig significantly suppressed proliferation at a concentration of 1 nM, which was more than 10 times more effective than the anti-human CD154 antibody 5c8 .

What are the established methods for producing recombinant canine CD40L for research applications?

Several approaches have been established for producing recombinant canine CD40L:

1. Fusion protein production:

  • Expression systems: The extracellular domain of canine CD40 can be fused with the Fc portion of mouse IgG2a using expression vectors like pcDNA3.1+

  • Cell lines: Dhfr-deficient CHO cells have been successfully used for stable expression

  • Selection and amplification: Methotrexate concentration gradients can be used to select high-producing clones

  • Purification: Standard protein purification techniques (chromatography) yield purified proteins suitable for research applications

2. Soluble CD40L production:

  • Researchers have constructed expression vectors by cloning the extracellular domain of canine CD40L fused to the signal sequence of canine IL-12p40

  • This approach yields functional soluble CD40L that can be used to induce maturation of dendritic cells

3. Adenoviral vector systems:

  • Human adenovirus serotype 5 carrying human CD40L has been used successfully in canine studies

  • These constructs allow for localized expression of CD40L when administered intratumorally

What analytical methods are recommended for verifying the identity and activity of recombinant canine CD40L?

For comprehensive characterization of recombinant canine CD40L, the following analytical methods are recommended:

Structural and identity verification:

  • Mass spectrometry: Confirms the identity and integrity of the produced protein

  • SDS-PAGE: Verifies size and purity (>95% purity is typically achievable)

  • Western blotting: Confirms immunoreactivity with specific antibodies

Functional assays:

  • Mixed leukocyte reactions (MLR): Quantitatively measures immunosuppressive or immunostimulatory effects

  • B-cell proliferation assays: Assesses biological activity on target cells

  • Dendritic cell maturation: Evaluates ability to induce phenotypic and functional maturation of dendritic cells

Expression analysis:

  • Flow cytometry: Measures binding to CD40-expressing cells using fluorescently-labeled antibodies against CD40L or detection of Fc-tagged constructs

Research has demonstrated that functional assessment through MLR provides robust validation, with canine CD40-Ig showing concentration-dependent effects (significant reduction in 3H-thymidine cellular uptake at 1 nM and nearly complete blocking at 10 nM) .

How can recombinant canine CD40L be used to support primary B-cell cultures for lymphoma research?

Recombinant canine CD40L has been instrumental in establishing and maintaining primary B-cell cultures from lymphoma samples, addressing a significant challenge in preclinical cancer research. The methodology includes:

CD40L-based culture systems:

  • Feeder cell approach: Human K562 cells transduced with human CD40L (KtCD40L) can be used to support primary dog diffuse large B-cell lymphoma (DLBCL) cells in vitro

  • Soluble CD40L approach: Recombinant soluble human CD40L in a two-trimeric form can support primary lymphoma cells without the need for feeder cells

Protocol highlights:

  • Isolation of primary DLBCL cells from canine samples

  • Co-culture with KtCD40L feeder cells or addition of soluble CD40L

  • Supplementation with appropriate growth factors and media

  • Regular assessment of cell phenotype, clonality, and karyotypic abnormalities

This system allows primary lymphoma cells to retain their original phenotype, clonality, and known karyotypic abnormalities after extended expansion in culture, providing a more representative model for preclinical studies than established cell lines .

What role does recombinant canine CD40L play in dendritic cell maturation protocols?

Recombinant canine CD40L serves as a critical component in protocols designed to generate mature dendritic cells (DCs) for immunological studies and potential immunotherapeutic applications:

Dendritic cell maturation protocol:

  • Isolation of canine peripheral blood mononuclear cells (PBMCs)

  • Culture with canine granulocyte-macrophage colony-stimulating factor (GM-CSF) and IL-4 to induce immature DCs

  • Addition of canine soluble CD40L (csCD40L) to promote maturation

  • Morphological and phenotypic assessment of maturation status

Observed effects:

  • When PBMCs are cultured with GM-CSF and IL-4 alone, expression of CD86 is elevated, but most cells retain immature DC morphology

  • Following addition of csCD40L, cells shift to mature DC morphology

  • Expression of CD80, CD86, MHC class II, and CD1a is significantly enhanced

  • These changes can be observed even when csCD40L is present only during the second half of the culture period

The ability to generate mature DCs using recombinant canine CD40L provides valuable tools for studying antigen presentation, T-cell activation, and developing DC-based immunotherapies for canine diseases .

How is adenoviral CD40L (AdCD40L) being used in canine melanoma immunotherapy research?

Adenoviral CD40L (AdCD40L) has emerged as a promising immunotherapeutic approach for canine malignant melanoma, with research showing significant clinical outcomes:

Clinical protocol:

  • Treatment involves 1-6 weekly intratumoral and/or metastatic lymph node injections of human adenovirus serotype 5 carrying human CD40 ligand

  • Administration is performed under subcutaneous sedation with medetomidine/butorphanol

  • Local lidocaine anesthetic spray is used for oral treatments

  • Post-injection, sedation is reversed with atipamezole

Study outcomes from 32 canine melanoma cases:

  • Tumor locations: 23 oral, 5 cutaneous, 3 ungual, 1 conjunctival

  • WHO staging: 8 stage I, 9 stage II, 12 stage III, 3 stage IV

  • Treatment approach: 20 cases combined with cytoreductive surgery, 12 cases received immunotherapy alone

  • Clinical responses: 7 complete responses, 5 partial responses, 5 stable disease, 2 progressive disease

  • Median survival: 285 days (range 20-3435 days)

  • Histological findings: Tumor tissue showed infiltration with T and B lymphocytes after treatment, suggesting immune stimulation

A noteworthy observation was at least one clear case of abscopal effect, where a distant metastatic lesion in the CNS showed immune activation following treatment of a prescapular lymph node metastasis .

How does canine CD40-Ig fusion protein compare to anti-CD154 antibodies in transplantation models?

Research comparing canine-specific CD40-Ig fusion protein to anti-CD154 antibodies in transplantation models has revealed important differences in efficacy and mechanism:

Comparative effectiveness:

  • In mixed leukocyte reaction (MLR) assays, canine CD40-Ig significantly suppressed proliferation at a concentration of 1 nM

  • This effect was more than 10 times more potent than the anti-human CD154 antibody 5c8

  • At 10 nM, CD40-Ig blocked MLR nearly completely, while 5c8 showed no blocking activity at this concentration

  • CD40-Ig was significantly more active than both rhCTLA4-Ig and the mouse anti-human CD154 antibody 5c8 (P = 0.00098 and P = 0.00096, respectively)

Molecular considerations:

  • The fusion construct of the extracellular domain of CD40 and the Fc portion of immunoglobulin blocks T-cell activation

  • The Fc tail provides dimerization of the molecule, which is necessary for optimal CD40-Ig activity

  • Species-specific reagents demonstrate superior performance compared to cross-reacting human reagents

These findings suggest that canine-specific CD40-Ig could improve outcomes in canine models of marrow transplantation and potentially allow for reduced conditioning regimen intensity from the current nonmyeloablative dose of 2 Gy total body irradiation to 1 Gy or lower .

What are the optimal experimental conditions for using recombinant canine CD40L in functional assays?

When incorporating recombinant canine CD40L in functional assays, the following optimized conditions should be considered:

Concentration requirements:

  • For mixed leukocyte reactions (MLR), canine CD40-Ig shows significant activity at 1 nM and optimal blocking at 10 nM

  • No significant differences were observed between 10 nM, 100 nM, and 200 nM concentrations of CD40-Ig

  • For comparison, anti-CD154 antibody 5c8 requires at least 100 nM for effective blocking

Cross-linking considerations:

  • The activity of soluble CD40L can be significantly enhanced (up to 1000-fold) by cross-linking

  • For human recombinant soluble CD40L, cross-linking enhancers allow stimulation in the ng/ml range

  • Similar principles likely apply to canine CD40L, though specific cross-linking requirements may vary

Cell-based assays:

  • For B-cell proliferation, supplementing culture medium with 5% fetal calf serum or carrier protein is recommended

  • For dendritic cell maturation assays, canine PBMCs should first be cultured with GM-CSF and IL-4, followed by CD40L addition

  • For mixed leukocyte reactions using canine CD40-Ig, protocols should include proper controls (medium alone, irrelevant proteins)

What experimental controls are essential when evaluating canine CD40L effectiveness in immunomodulatory studies?

Rigorous experimental controls are crucial when assessing the immunomodulatory effects of canine CD40L:

Positive controls:

  • Known immunostimulatory agents (LPS, CpG) for comparison of activation patterns

  • Species-matched positive control proteins (when available)

  • Cross-reactive human CD40L at validated concentrations

Negative controls:

  • Medium alone to establish baseline responses

  • Irrelevant proteins of similar structure (e.g., unrelated Ig fusion proteins)

  • Inactive CD40L mutants or heat-inactivated preparations

Assay-specific controls:

  • For flow cytometry: Isotype controls (mouse IgG1) for background fluorescence assessment

  • For dendritic cell maturation: Cells treated with GM-CSF and IL-4 alone to establish baseline maturation

  • For B-cell stimulation: Unstimulated B cells and cells stimulated with established B-cell mitogens

Validation approaches:

  • Dose-response experiments to establish optimal concentrations

  • Time-course studies to determine optimal timing of CD40L addition

  • Blocking experiments using anti-CD40 antibodies to confirm specificity

For phenotypic analysis of CD40 expression in canine tumors, researchers have employed anti-human CD22 labeled with Zenon Alexa-Fluor 647 probes and human CD154 (CD40L)-muCD8/Biotin with streptavidin-FITC to ensure specific detection .

How does the CD40-CD40L pathway interact with other immune checkpoint molecules in canine cancer models?

The interaction between the CD40-CD40L pathway and other immune checkpoint molecules in canine cancer models reveals complex immunoregulatory networks:

Key interactions and relationships:

  • CD40-CD40L and CTLA-4/B7: Studies comparing canine CD40-Ig and CTLA4-Ig show distinct but potentially complementary mechanisms of immune modulation

  • CD40 signaling and PD-1/PD-L1 axis: CD40 activation can influence PD-L1 expression on antigen-presenting cells, potentially affecting T cell exhaustion

  • Integration with inflammatory cytokine networks: CD40L stimulation influences production of TNF-α, IL-8, and IL-10

Research findings in canine models:

  • In AdCD40L-treated canine melanoma, immunological responses include alterations in serum cytokines (TNF-α, IL-8, and IL-10)

  • Treatment leads to development of neutralizing antibodies in 100% of dogs after the third immunotherapy session

  • CD40 activation appears to modulate the T-cell response suppressor IL-10

Understanding these interactive networks is critical for designing combination immunotherapies. The observed abscopal effects in some canine melanoma cases treated with AdCD40L suggest systemic immune activation that may involve multiple checkpoint pathways .

What are the potential mechanisms behind abscopal effects observed in AdCD40L-treated canine melanoma patients?

The observation of abscopal effects (regression of untreated distant tumors) in AdCD40L-treated canine melanoma patients suggests several potential immunological mechanisms:

Proposed mechanisms:

  • Systemic T-cell activation and trafficking:

    • AdCD40L treatment leads to maturation of dendritic cells that present tumor antigens

    • Activated T cells recognize these antigens and traffic to distant tumor sites

    • Histological evidence shows T-lymphocyte infiltration in distant metastatic lesions

  • Cytokine-mediated effects:

    • CD40L stimulation induces production of inflammatory cytokines (TNF-α, IL-8)

    • These cytokines may have direct anti-tumor effects and recruit immune cells to distant sites

    • Changes in IL-10 levels may reduce immunosuppression systemically

  • Antibody-dependent mechanisms:

    • Development of neutralizing antibodies following AdCD40L therapy

    • Potential development of anti-tumor antibodies that target distant metastases

Case evidence:
In one documented case, a dog receiving AdCD40L injection in a metastatic prescapular lymph node developed seizures three days after each injection, leading to the discovery of a previously undetected brain metastasis. Post-mortem examination revealed T-lymphocyte infiltration in this CNS metastatic lesion, providing direct evidence of immune cell trafficking to distant sites. This timing (seizures occurring three days post-injection) and histological findings strongly support an abscopal effect of the AdCD40L injection .

How do findings from canine CD40L studies translate to human clinical applications?

Findings from canine CD40L studies have provided valuable insights for human clinical applications, establishing dogs as an important translational model:

Translational relevance:

  • Canine spontaneous melanoma is recognized as an excellent model for human melanoma due to similar biological behavior and metastatic patterns

  • The comparable safety profile and immune responses observed in dogs have informed human clinical trial designs

  • Similar molecular mechanisms of CD40-CD40L interaction operate in both species, despite some structural differences

Parallel clinical development:

  • A human clinical trial with 15 treatment-refractory melanoma patients used intratumoral AdCD40L injections similar to the canine protocol

  • Nine patients also received low-dose cyclophosphamide conditioning before the first and fourth AdCD40L injections

  • Similar to canine findings, human patients experienced mild transient side effects

  • While MRI showed no macroscopic objective responses, FDG-PET revealed local and distant responses

  • Six-month survival appeared improved when cyclophosphamide was added to AdCD40L

  • Patients with the best survival developed the highest levels of activated T cells and experienced pronounced decreases in intratumoral IL-8

These parallel findings demonstrate how canine studies have directly informed human clinical approaches, with ongoing clinical translation between species .

What unique insights do canine models provide for CD40L-based immunotherapies compared to murine models?

Canine models offer several distinct advantages over traditional murine systems for studying CD40L-based immunotherapies:

Advantages of canine models:

  • Spontaneous tumor development:

    • Dogs naturally develop malignancies like melanoma and lymphoma with similar biological behavior to human diseases

    • This contrasts with artificially induced or transplanted tumors in murine models

  • Comparable tumor heterogeneity:

    • Canine tumors display heterogeneity similar to human cancers

    • This heterogeneity affects therapeutic responses and immune evasion mechanisms

  • Shared environmental exposures:

    • Dogs share environments with humans, experiencing similar environmental factors that may influence disease development and treatment response

  • Comparable size and physiology:

    • The larger size of dogs allows for similar dosing and administration routes as used in humans

    • Similar pharmacokinetics and metabolism of therapeutic agents

  • Longer lifespan:

    • Dogs have longer lifespans than mice, allowing for better assessment of long-term outcomes and delayed effects

    • The longest survival in AdCD40L-treated canine melanoma was 3435 days, providing valuable long-term efficacy and safety data

  • Intact immune system:

    • Unlike many murine models that require immunodeficient backgrounds, canine studies evaluate therapies in the context of a naturally developed, intact immune system

These unique features make canine studies with CD40L-based therapies particularly informative for translational development, offering insights that bridge the gap between artificial murine systems and human clinical applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.