Recombinant Dog Cholecystokinin receptor type A (CCKAR)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

Recombinant CCKAR is produced in E. coli systems, followed by affinity chromatography for purification. Key parameters include:

  • Buffer Composition: PBS (pH 7.4) with 0.01% SKL, 1 mM DTT, 5% Trehalose, and Proclin300 .

  • Endotoxin Levels: <1 EU/µg .

  • Storage: Lyophilized at -20°C or -80°C for long-term stability .

Receptor Activation

CCKAR binds cholecystokinin to regulate pancreatic enzyme secretion, gallbladder contraction, and satiety . Calcium mobilization assays confirm its functional activity in transfected CHO-K cells .

Immune System Interactions

While primarily studied in dogs, cross-species research indicates CCKAR modulates immune responses. In chickens, pathogen-derived stimuli (e.g., lipopolysaccharides) regulate CCKAR expression on monocytes, correlating with proinflammatory cytokine levels .

Therapeutic Target Validation

CCKAR is investigated for obesity treatment due to its role in appetite suppression. Recombinant proteins enable high-throughput screening of receptor agonists/antagonists .

Immunoassays

An ELISA kit (SEA104Ca) demonstrates high specificity for CCKAR detection, with:

  • Intra-assay Precision: CV <10% .

  • Inter-assay Precision: CV <12% .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CCKAR; Cholecystokinin receptor type A; CCK-A receptor; CCK-AR; Cholecystokinin-1 receptor; CCK1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MEVADSLLGNGSDVPPPCELGLENETLVCLEQPRAAKEWQPAVQILLYSLIFLLSVLGNT LVITVLIRNKRMRTVTNIFLLSLAVSDLMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYF MGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIATTWCLSFTIMTPYPIYS NLVPFTKTNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELYQGI KFDAIQKKSARDRNPSTGSSGRYEDGDGCYLQKARPRRRLELRQLSTPGSGRLNRIRSTS STANLMAKKRVIRMLMVIVVLFFLCWMPIFSANAWRAYDTASAERRLSGTPISFILLLSY TSSCVNPIIYCFMNKRFRLGFLATFPCCPHPGPPGPRGEVGEEEEGRTTGASLSRYSYSH MSASAPGP
Uniprot No.

Target Background

Function
The Cholecystokinin receptor type A (CCKAR) is a receptor for cholecystokinin. It plays a key role in mediating pancreatic growth and enzyme secretion, smooth muscle contraction of the gallbladder and stomach. CCKAR exhibits a 1000-fold higher affinity for cholecystokinin (CCK) compared to gastrin. Furthermore, it modulates feeding behavior and dopamine-induced behavior in both the central and peripheral nervous systems. This receptor exerts its effects by associating with G proteins, which activate a phosphatidylinositol-calcium second messenger system.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Canine Cholecystokinin Receptor Type A (CCKAR) and What are its Primary Functions?

CCKAR, also referred to as CCK1 receptor in scientific literature, is a G-protein coupled receptor that binds cholecystokinin (CCK). In canine physiology, CCKAR mediates several crucial digestive functions including pancreatic growth and enzyme secretion, as well as smooth muscle contraction of the gallbladder and stomach .

The full-length canine CCKAR was cloned from gallbladder tissue using RT-PCR with primers targeting conserved regions that share homology between human, rat, and canine genomic sequences . Analysis revealed that canine CCKAR contains a 1287 base pair product encoding a 429 amino-acid protein, which shares 89% identity with human CCKAR and 85% identity with rat CCKAR .

What Methods Are Recommended for Recombinant Expression of Canine CCKAR?

Chinese Hamster Ovary (CHO) cells have proven to be an effective expression system for producing functional recombinant canine CCKAR. This approach offers several advantages for research applications:

Expression Protocol for Recombinant Canine CCKAR:

  • Cloning the full-length canine CCKAR gene using RT-PCR from gallbladder tissue

  • Construction of expression vectors containing the canine CCKAR sequence

  • Transfection into CHO-K cells

  • Selection and establishment of stable cell lines expressing the receptor

  • Validation of expression through binding assays

This expression system yields approximately 25-fold higher receptor density compared to native pancreatic acinar cells, providing an ideal substrate for structure-function relationship studies . Despite structural differences in glycosylation patterns between recombinant and native receptors, the recombinant CCKAR maintains functional properties that are indistinguishable from the native receptor .

How Can Recombinant Canine CCKAR Be Pharmacologically Characterized?

Pharmacological characterization of recombinant canine CCKAR typically involves competition binding studies using radioligands such as [(125)I]BH-CCK-8S . This approach allows researchers to determine the affinity values for various CCK receptor-selective compounds.

Table 1: Affinity Values for CCK Receptor-Selective Compounds at Canine CCKAR

CompoundAffinity at Canine CCKAR (pKI ± s.e.m.)
L-364,7188.82 ± 0.08
L-365,2606.61 ± 0.05
YF4767.91 ± 0.15
YM0228.28 ± 0.06
Dexloxiglumide7.53 ± 0.11

These pharmacological studies have demonstrated that the affinity values for CCK receptor-selective compounds are not significantly different between canine and human CCKAR . Additionally, the selectivity of these compounds between canine CCKAR and CCKBR (CCK2 receptor) is consistent with the selectivity observed between human CCKAR and CCKBR .

What Variants of Canine CCKAR Have Been Identified and How Do They Differ Functionally?

During cloning procedures, researchers have identified two additional forms of canine CCKAR beyond the wild-type receptor :

Variant Characteristics:

  • Wild-type CCKAR: The standard form, encoding a 429 amino acid protein

  • Variant #1: Contains three amino acid differences from the wild-type receptor

  • Variant #2: Contains six amino acid differences from the wild-type receptor

Functional analysis revealed that Variant #1 successfully bound [(125)I]BH-CCK-8S and displayed an identical pharmacological profile to the wild-type receptor, suggesting these amino acid differences do not affect ligand binding or receptor function . In contrast, no significant binding was measured with Variant #2, indicating that the six amino acid differences in this variant disrupt the receptor's ligand-binding capabilities .

These findings provide valuable insights into structure-function relationships within the CCKAR molecule and highlight specific amino acid residues that may be critical for receptor function.

What Are the Structural Differences Between Native and Recombinant Canine CCKAR?

Comparative studies between native and recombinant CCKAR have revealed interesting structural differences, primarily related to post-translational modifications :

Further analysis using lectin-binding experiments confirmed that both native and recombinant CCKAR represent complex glycoproteins, but only the native receptor bound Ulex europeus agglutinin I, which specifically recognizes fucose residues . This suggests that the distinct processing observed affects terminal glycosylation steps, potentially the addition of fucose residues that occurs late in glycoprotein biosynthesis .

Despite these structural differences, the recombinant CCKAR remains functionally equivalent to the native receptor in terms of signaling capabilities, sensitivity to stable GTP analogues, and binding affinities for agonists and antagonists .

What Methods Are Available for Detecting and Quantifying Recombinant CCKAR?

Several methods are available for detecting and quantifying recombinant CCKAR in research settings:

Enzyme-Linked Immunosorbent Assay (ELISA)

ELISA represents a common method for quantitative determination of canine CCKAR in tissue homogenates and other biological fluids . Commercial kits typically feature:

  • Detection range: 0.312-20 ng/mL

  • Sensitivity: Less than 0.124-0.13 ng/mL

  • High specificity with no significant cross-reactivity

  • Sample volume requirements: 50-100 μL

The standard ELISA procedure involves:

  • Sample preparation and addition to pre-coated wells

  • Incubation with detection reagents (1 hour at 37°C)

  • Washing steps and incubation with secondary reagents

  • Addition of substrate solution and color development

  • Measurement at 450 nm

For optimal results, sample concentrations should be diluted to the mid-range of the detection curve .

Radioligand Binding Assays

For pharmacological characterization, radioligand binding assays using ligands such as [(125)I]BH-CCK-8S allow for direct measurement of receptor binding properties . This approach is particularly useful for comparing binding affinities between wild-type and variant forms of the receptor, or between species.

How Can CCKAR Expression Be Assessed at the mRNA Level?

Quantitative real-time PCR (qRT-PCR) represents the gold standard for assessing CCKAR expression at the mRNA level . The procedure typically involves:

  • RNA Extraction: Total RNA is extracted from tissue samples using TRIzol reagent or similar methods

  • cDNA Synthesis: Reverse transcription of RNA to cDNA using appropriate kits (e.g., ReverTra kit)

  • qRT-PCR: Using CCKAR-specific primers:

    • Forward: 5'-ATGGATGTGGTTGACAGCCTT-3'

    • Reverse: 5'-AAGCGTCTCATTTTCGAGCCC-3'

  • Data Analysis: Quantification using the 2^-ΔΔCt method with GAPDH as an internal control

This method allows for sensitive detection of CCKAR mRNA expression levels and can be used to compare expression between different tissues or under various experimental conditions.

What Animal Models Are Available for Studying Recombinant CCKAR Function?

Engineered mouse models have been developed to facilitate the study of CCKAR function in vivo . One approach involves expressing Cre-recombinase under the control of CCKAR regulatory sequences:

  • A Cre-expressing DNA sequence is synthesized and inserted downstream of the CCKAR start codon

  • This construct is then injected into mouse embryos to develop transgenic mouse lines

  • The resulting model allows for conditional gene manipulation in CCKAR-expressing cells

These models enable the generation of various preclinical systems to study CCKAR activity and its role in numerous disease states, including diabetes, obesity, and irritable bowel syndrome . They represent valuable tools for understanding receptor function in a physiological context and for testing potential therapeutic interventions.

How Does Canine CCKAR Compare to Human and Other Species' CCKAR?

Comparative analysis of CCKAR across species reveals both conservation and divergence:

The canine CCKAR protein shares 89% identity with human CCKAR and 85% identity with rat CCKAR at the amino acid level . This high degree of sequence homology is reflected in similar pharmacological properties across species.

In competition binding studies, the affinity values for CCK receptor-selective compounds (including L-364,718, L-365,260, YF476, YM022, and dexloxiglumide) were not significantly different between canine and human CCKAR . Furthermore, the selectivity profiles of these compounds between CCKAR and CCKBR (CCK2 receptor) were consistent across species .

These findings suggest that recombinant canine CCKAR represents a suitable model for studying human CCKAR pharmacology and function, with implications for translational research in various diseases.

What Are the Implications of CCKAR in Disease Research?

CCKAR has been implicated in various pathological conditions, making it an important target for disease research:

Cancer Research

CCKAR has been investigated as a biomarker for prognosis and asynchronous brain metastases . Studies have shown that CCKAR is expressed in the cytoplasm and membrane of various cancer cells, and its expression can be detected and semi-quantified using immunohistochemistry (IHC) .

Metabolic Disorders

Given CCKAR's role in regulating food intake, satiety, and gut motility, it represents a potential target for treating metabolic disorders such as diabetes and obesity . Recombinant expression systems and animal models enable detailed studies of receptor function and pharmacological modulation.

Gastrointestinal Disorders

CCKAR's involvement in regulating gut motility makes it relevant for research on gastrointestinal disorders such as irritable bowel syndrome . Understanding the molecular mechanisms of receptor function could lead to novel therapeutic approaches.

What Quality Control Measures Are Important When Working With Recombinant CCKAR?

Ensuring the quality and functionality of recombinant CCKAR is crucial for reliable research outcomes:

  • Expression Verification: Confirm successful expression through Western blotting, ELISA, or radioligand binding assays

  • Functional Validation: Verify that the recombinant receptor initiates appropriate signaling cascades in response to ligand binding

  • Glycosylation Analysis: Consider the impact of glycosylation differences between recombinant and native receptors

  • Stability Assessment: Determine the stability of the recombinant receptor under experimental conditions

  • Batch Consistency: Monitor batch-to-batch variation, especially when using commercial kits

For ELISA-based detection, it's important to note that kits from different batches may show slight differences in detection range, sensitivity, and color development . Therefore, standardization and appropriate controls are essential for reliable results.

What Are the Current Challenges in Recombinant CCKAR Research?

Several challenges persist in recombinant CCKAR research:

  • Glycosylation Differences: As discussed earlier, recombinant CCKAR exhibits different glycosylation patterns compared to native receptors, which may affect certain properties while maintaining core functionality

  • Species Differences: Despite high homology, species-specific differences in CCKAR structure and function may limit the translational value of findings across species

  • Variant Characterization: While some variants of canine CCKAR have been identified , comprehensive characterization of all potential variants and their functional implications remains incomplete

  • Integration with In Vivo Models: Connecting findings from recombinant expression systems with physiological observations in animal models represents an ongoing challenge

Addressing these challenges requires continued refinement of recombinant expression systems, development of improved detection methods, and integration of findings across multiple experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.