Recombinant Dog Claudin-2 (CLDN2)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Dog Claudin-2 (CLDN2)

Recombinant Dog Claudin-2 (CLDN2) is a synthetically produced version of the canine claudin-2 protein, a key component of tight junctions in epithelial and endothelial cells. This recombinant protein is engineered for research applications to study paracellular ion transport, epithelial barrier function, and disease mechanisms in veterinary and comparative biology contexts .

Table 1: Comparative Features of Claudin-2 Across Species

SpeciesLength (aa)Molecular Weight (kDa)Key Tissue Expression
Human23024.5Intestine, Kidney
Mouse23024.5Intestine, Liver
Dog~230*~24.5*Intestine, Kidney*
*Inferred from homology .

Functional Roles

  • Paracellular Transport: Forms cation- and water-selective channels, enabling energy-efficient ion flux in renal proximal tubules and intestinal epithelia .

  • Disease Relevance: Modulates mucosal healing in colitis and influences cancer progression via pathways involving EGFR and Survivin .

Key Studies Involving Canine CLDN2

  1. Antibody Cross-Reactivity:

    • A polyclonal antibody (Thermo Fisher #51-6100) confirmed reactivity with dog CLDN2 in immunofluorescence assays, validating its use in canine tissue studies .

    • Observed localization at tight junctions in kidney and intestinal epithelial cells, consistent with human/mouse CLDN2 .

  2. Pathophysiological Insights:

    • Colitis Models: In mice, CLDN2 overexpression reduced colitis severity by enhancing mucosal repair . Similar mechanisms are hypothesized in dogs, though direct evidence remains limited .

    • Cancer Research: CLDN2 upregulation correlates with poor survival in human colorectal cancer, suggesting conserved oncogenic roles in canine cancers .

Table 2: Experimental Data from Cross-Species Studies

ParameterHuman CLDN2Mouse CLDN2Dog CLDN2 (Inferred)
TEER Reduction (Upon Overexpression)30% decrease 25–40% decrease Not tested
Role in ColitisProtective Protective Hypothesized similar
Cancer AssociationPro-tumorigenic Pro-tumorigenic Unknown

Production and Validation

  • Expression Systems: Recombinant dog CLDN2 is produced in E. coli, HEK293, or wheat germ systems, with tags (His, GST) for purification .

  • Functional Assays:

    • Permeability Assays: Validated using Madin-Darby canine kidney (MDCK) cell monolayers to measure transepithelial electrical resistance (TEER) .

    • Protein-Protein Interactions: Co-immunoprecipitation confirms binding to ZO-1/ZONAB complexes, critical for signaling in proliferation and metastasis .

Challenges and Future Directions

  • Species-Specific Data Gaps: Limited direct studies on dog CLDN2 necessitate reliance on cross-species extrapolation.

  • Therapeutic Potential: Targeting CLDN2 could aid in treating canine inflammatory bowel disease (IBD) or cancers, pending species-specific mechanistic studies .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will accommodate your request as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
CLDN2; Claudin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
CLDN2
Target Protein Sequence
MASLGLQLVGYILGLLGLLGTLVAMLLPSWRTSSYVGTSIVTAVGFSKGLWMECATHSTG ITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIVSVVGMRCTVFCQDSRAKDRLAVV GGVFFIIGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGII LCFSCPLQGNRSDYYDSYQAQPLATRGSPRPGQPPKAKSEFNSYSLTGYV
Uniprot No.

Target Background

Function
Claudin-2 plays a significant role in tight junction-specific obliteration of the intercellular space, facilitated through calcium-independent cell-adhesion activity.
Gene References Into Functions
  1. Hypotonic stress induces dephosphorylation, clathrin-dependent endocytosis, and degradation of claudin-1 and -2 in lysosomes. This leads to disruption of the tight junction barrier in renal tubular epithelial cells. PMID: 27733684
  2. Claudin-2 independently determines the 'leaky' property of Tight Junctions in MDCK II cells. PMID: 25781928
  3. PKCiota binds to Rab14, and PKCiota requires Rab14 for its proper distribution within cells. Similar to Rab14, PKCiota protects claudin-2 from lysosomal degradation, consequently modulating epithelial barrier function. PMID: 25694446
  4. IQGAP1 modulates tight junction formation through a dual mechanism: (1) regulating the expression and recruitment of claudin 2 and claudin 4 to the tight junction, and (2) transient inhibition of the CDC42-JNK pathway. PMID: 25588839
  5. These findings suggest that hyperosmolarity decreases the expression level of claudin-2 by reducing PKCbeta-dependent GATA-2 transcriptional activity in renal tubular epithelial cells. PMID: 25825272
  6. These results indicate that Rab14 is involved in specialized trafficking of claudin-2 from the recycling endosome. PMID: 24694596
  7. These findings suggest that EGF controls the levels of CLDN-2 and -4 proteins and mRNAs through Src and STAT3 activity. PMID: 24909426
  8. YM201636 treatment inhibits the continuous recycling of claudin-1/claudin-2 and delays epithelial barrier formation. PMID: 22396724
  9. Epidermal growth factor accelerates clathrin-dependent endocytosis and lysosomal degradation of CLDN2 protein. PMID: 21660968
  10. These findings suggest that the decrease in claudin-2 expression enhances cell migration mediated by the increase in the expression and activity of MMP-9. PMID: 20717932
  11. The ERK 1/2 signaling pathway negatively controls claudin-2 expression in mammalian renal epithelial cells. This provides evidence for the regulation of tight junction paracellular transport by alterations in claudin composition within tight junction complexes. PMID: 15569684
  12. These results offer novel insights about the mechanisms of cingulin function and the signaling pathways controlling claudin-2 expression in Madin-Darby canine kidney (MDCK) cells. PMID: 16723500
  13. Claudin-2 expression significantly increased in the proximal crypt and luminal colonic epithelium in affected dogs, suggesting a role in the pathogenesis of canine LPC. PMID: 17595339
  14. The discovery of claudin 2 transcript and protein in the skin could be of importance in epidermal differentiation, barrier function and pathological conditions. PMID: 18509255
  15. LNX1p80 is involved in the ubiquitylation, endocytosis and lysosomal degradation of claudins, and the turnover of tight junctions is regulated by ubiquitylation. PMID: 19295125
  16. This report demonstrates downregulation of claudin-2 expression in renal epithelial cells by metabolic acidosis. PMID: 19587148

Show More

Hide All

Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of canine Claudin-2 and how does it compare to human Claudin-2?

Canine Claudin-2 is a tetraspan transmembrane protein with two extracellular loops (EL1 and EL2), an intracellular N-terminus, and a cytoplasmic C-terminal tail. The protein consists of 230 amino acids with a molecular weight of approximately 24.5 kDa .

The structure includes highly conserved regions, particularly the 49GLW51 sequence in the first extracellular domain, which is critical for function . Structurally, dog and human Claudin-2 share significant homology, but with key differences in certain amino acid residues that may affect antibody binding and functional properties. Both contain perimembrane cysteines in the second (TM2) and fourth (TM4) transmembrane domains that are important for protein stability and function .

What are the primary physiological functions of Claudin-2 in canine epithelial tissues?

Claudin-2 forms paracellular channels that polymerize in tight junction strands, creating cation- and water-selective channels through these strands. This process is known as paracellular tight junction permeability . In canine epithelial tissues, Claudin-2 primarily:

  • Regulates epithelial permeability by forming size- and charge-selective paracellular pores with conductances of ~90 pS

  • Enables passive sodium and calcium reabsorption across proximal tubules in the kidney

  • Facilitates paracellular water and cation fluxes in hepatobiliary tract tissues

  • Contributes to intestinal barrier function and nutrient absorption

Studies with Claudin-2-deficient mice have demonstrated that the absence of this protein significantly decreases net transepithelial reabsorption of Na+, Cl-, and water, confirming its critical role in epithelial function .

Experimental Models and Methods

Several complementary techniques are available for detection and quantification:

  • Western Blotting: For protein expression level assessment

    • Sample preparation: Cells can be lysed in detergent-containing buffer (e.g., DDM)

    • Analysis: SDS-PAGE followed by immunoblotting with anti-Claudin-2 antibodies

    • Expected result: Band at approximately 24.5 kDa

  • Immunofluorescence/Immunocytochemistry:

    • Sample preparation: Fix cells with 4% paraformaldehyde for 5 minutes, permeabilize with 0.1% Triton X-100 for 10 minutes, and block with 2% BSA

    • Analysis: Incubate with primary anti-Claudin-2 antibodies followed by fluorescence-labeled secondary antibodies

    • Expected result: Junctional staining pattern at cell-cell contacts

  • BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis):

    • For analysis of native protein complexes and oligomeric state

    • Can be combined with electroelution and mass spectrometry for detailed characterization

  • RT-qPCR:

    • For mRNA expression analysis

    • Useful for studying transcriptional regulation

  • Trans-tight junction patch clamp technique:

    • For functional analysis of individual Claudin-2 channels

    • Allows detection of flux across individual channels within tight junctions

How can researchers generate stable cell lines expressing recombinant dog Claudin-2?

A methodological approach includes:

  • Vector selection and cloning:

    • Clone Claudin-2 cDNA into appropriate expression vectors (e.g., pTRE for tet-regulated expression)

    • Consider adding epitope tags or fluorescent protein fusions for detection

    • For specific mutations, use site-directed mutagenesis (e.g., QuikChange kit)

  • Transfection method:

    • Lipid-based transfection (e.g., Lipofectamine) is effective for MDCK cells

    • Co-transfect with selection marker (e.g., pSV Zeo)

  • Selection of stable clones:

    • Apply appropriate antibiotic selection (e.g., 1 mg/ml Zeocin)

    • Isolate and expand multiple independent clones

  • Validation:

    • Confirm expression by Western blot and immunofluorescence

    • Verify localization to tight junctions

    • Measure functional parameters (e.g., transepithelial electrical resistance, ion selectivity)

  • Functional testing:

    • Measure transepithelial electrical resistance (TER)

    • Assess paracellular permeability to ions and small molecules

    • Expected results include decreased TER and increased cation selectivity upon Claudin-2 expression

What electrophysiological techniques are most effective for studying Claudin-2 channel properties?

Several complementary electrophysiological approaches provide valuable insights into Claudin-2 channel properties:

  • Trans-tight junction patch clamp technique:

    • A novel approach that detects flux across individual Claudin-2 channels

    • Reveals that Claudin-2 channels display conductances of ~90 pS and are gated with sub-millisecond kinetics

    • Kinetic analyses indicate one open and two distinct closed states

    • Allows characterization of channel opening/closing events

  • Ussing chamber measurements:

    • For measuring ion flux across epithelial monolayers

    • Can determine ion selectivity by replacing ions in the bathing solutions

    • Claudin-2 expression increases Na+ conductivity without affecting Cl- conductivity

  • Transepithelial electrical resistance (TER) measurements:

    • Simple method to assess barrier function

    • MDCK cells expressing Claudin-2 show decreased TER (~100 Ω·cm²) compared to non-expressing cells (>1,000 Ω·cm²)

    • Expression of Claudin-2 in high-resistance epithelia reduces TER by increasing paracellular permeability

  • Ion selectivity measurements:

    • Dilution potentials can be used to calculate relative ion permeabilities

    • Claudin-2 confers high selectivity for cations over anions (PCl/PNa ≈ 0.12)

    • Size selectivity can be determined using different sized ionic probes

How do mutations in key domains of Claudin-2 affect its channel function and protein interactions?

Mutational studies have revealed several functional domains in Claudin-2:

Domain/ResidueMutationFunctional EffectMethodological ApproachReference
First extracellular domain (49GLW51)Replacement with AAADisrupts channel formation and tight junction integritySite-directed mutagenesis, functional assays
Perimembrane cysteines (C104, C108, C182, C185)Cysteine to serine mutationsAffects protein stability and oligomerizationSite-directed mutagenesis, cross-linking studies
Ile66Chemical derivatizationBlocks channel conductanceCysteine mutagenesis combined with chemical modification

Researchers can employ the following methods to study these mutations:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Cross-linking with photo-activated cross-linkers (NHS-diazirine, NHS-LC-diazirine, or Sulfo-NHS-SS-diazirine)

    • BN-PAGE for analysis of native protein complexes

  • Functional characterization:

    • Trans-tight junction patch clamp to measure single-channel conductance

    • Ussing chamber experiments to assess ion selectivity

    • FRET or BRET to analyze protein-protein interactions in living cells

These approaches have revealed that Claudin-2 forms homodimers and is a component of high molecular weight complexes in tight junctions , and specific residues are critical for channel function.

How is Claudin-2 expression altered in canine disease models, and what are the functional consequences?

Claudin-2 expression changes have been documented in several canine disease models:

  • Kidney disease models:

    • Increased Claudin-2 expression correlates with increased tubular permeability

    • Functional consequence: Impaired ion reabsorption and water handling

    • Research approach: Analyze kidney tissue samples using immunohistochemistry and correlate with serum electrolyte levels and renal function tests

  • Inflammatory bowel conditions:

    • Altered Claudin-2 expression affects intestinal barrier function

    • Functional consequence: Increased paracellular permeability leading to "leaky gut"

    • Research approach: Ex vivo intestinal permeability studies combined with tissue expression analysis

  • Cancer models:

    • Claudin-2 is required for colorectal cancer liver metastasis

    • Elevated expression in cancer cells is associated with poor survival

    • Research approach: Anti-Claudin-2 antibodies can be used to impair the growth of colorectal cancer cells in soft agar

  • Response to toxicants and infectious stressors:

    • MDCK cells express genes involved in innate immune response and show altered Claudin-2 expression when exposed to cadmium (Cd2+) or LPS

    • Functional consequence: Changes in epithelial barrier properties

    • Research approach: Measure cytokine release and gene expression after exposure to stressors

What are the emerging therapeutic applications targeting Claudin-2 in research models?

Several therapeutic strategies targeting Claudin-2 are being explored:

  • Antibody-drug conjugates (ADCs):

    • Anti-Claudin-2 antibodies conjugated with cytotoxic agents (e.g., PNU) have shown efficacy against claudin-2-expressing cancer cells

    • These ADCs are efficiently internalized and effective at killing Claudin-2-expressing colorectal cancer cells in vitro

    • In vivo studies showed that PNU-conjugated anti-Claudin-2 ADCs impaired the development of CRC liver metastases

    • Methodological approach: Generate and characterize anti-Claudin-2 antibodies, assess binding specificities, cross-reactivity, and efficacy in cell and animal models

  • Tight junction modulators:

    • Compounds that modulate Claudin-2 channel gating could regulate epithelial permeability

    • Potential applications in diseases characterized by barrier dysfunction

    • Research approach: High-throughput screening for compounds that affect Claudin-2 channel function, followed by electrophysiological and permeability validation

  • Gene therapy approaches:

    • Viral vectors carrying Claudin-2 cDNA have been used to modulate expression in cell models

    • Could potentially correct defects in Claudin-2 expression or function

    • Methodological approach: Viral transduction followed by functional assessment of epithelial barrier properties

How do Claudin-2 and Claudin-12 interact to regulate calcium homeostasis, and what methodologies can reveal their complementary functions?

Recent research has revealed important insights into the complementary roles of Claudin-2 and Claudin-12:

  • Functional complementarity:

    • Studies with double knockout mice (Cldn2/12 DKO) show that these claudins form independent, complementary pores for calcium transport

    • Single knockout of either gene does not result in altered serum calcium or bone mineralization, but double knockout causes:

      • Decreased intestinal calcium absorption

      • Renal calcium wasting

      • Hypocalcemia

      • Markedly reduced bone mineralization

  • Methodological approaches to study this interaction:

    • Animal models: Generate single and double knockout mice to assess phenotypic differences

    • Calcium flux measurements: Compare intestinal and renal calcium permeability between wild-type, single KO, and double KO tissues

    • Protein interaction studies: Co-immunoprecipitation, FRET analysis, or proximity ligation assays to determine if these claudins physically interact

    • Functional complementation: Express both claudins in different ratios to determine if their effects on calcium permeability are additive or synergistic

  • Research findings:

    • Claudin-2 and Claudin-12 don't physically interact in vitro

    • Their coexpression has an additive effect on calcium permeability

    • Both are important constituents of the paracellular Ca2+ pathway in intestine and kidney

This research highlights the importance of studying claudin family members not in isolation but as components of a complex system regulating epithelial permeability.

What is the molecular mechanism of Claudin-2 channel gating, and how can researchers investigate the dynamics of channel opening and closing?

The discovery that Claudin-2 channels are dynamically gated rather than static pores raises important questions about the mechanisms controlling channel opening and closing:

  • Current understanding of channel gating:

    • Claudin-2 channels display sub-millisecond gating kinetics with one open and two distinct closed states:

      • One fully open state

      • One firmly closed state

      • One temporarily closed but primed-to-open state

    • Conductance is symmetrical and reversible, characteristic of a passive paracellular process

  • Advanced methodological approaches:

    • Trans-tight junction patch clamp: Provides direct measurement of single-channel events

    • Site-directed mutagenesis and chemical derivatization: To identify residues involved in gating

    • Temperature manipulation: Channel activity is blocked by reduced temperature

    • Molecular dynamics simulations: Based on the claudin crystal structure to model conformational changes during gating

    • High-speed imaging: Combined with fluorescent protein tagging to visualize dynamic changes in claudin organization

  • Research considerations:

    • Any model of Claudin-2 function must account for the rapid opening and closing of the channel

    • The longer closed state may reflect transient disassembly of the claudin-2 channel complex

    • Understanding gating mechanisms could lead to development of pharmacological means of modulating tight junction permeability for therapeutic purposes

How do viral pathogens interact with and exploit Claudin-2 in host cells, and what experimental approaches can elucidate these mechanisms?

Recent research has revealed that certain viruses exploit Claudin-2 during infection:

  • Duck circovirus (DuCV) interaction with Claudin-2:

    • DuCV utilizes host CLDN2 proteins to enhance adhesion and infection in target organs

    • The capsid protein (Cap) of DuCV interacts with the extracellular loop structural domains EL1 and EL2 of CLDN2

    • DuCV infection triggers the MAPK-ERK signaling pathway, leading to upregulation of SP5 and CLDN2 expression

  • Methodological approaches to study virus-Claudin-2 interactions:

ApproachApplicationExpected Results
Co-immunoprecipitation (co-IP)Identify physical interactions between viral proteins and Claudin-2Precipitation of protein complexes containing both viral and claudin proteins
GST pull-down assaysConfirm direct binding between recombinant viral and claudin proteinsSpecific binding of purified proteins indicating direct interaction
ImmunofluorescenceVisualize colocalization of viral proteins and Claudin-2Overlapping signals at cell-cell junctions or other cellular compartments
Adhesion-blocking assaysDetermine if Claudin-2 facilitates viral attachmentReduced viral binding when Claudin-2 is blocked or depleted
Transcriptome analysisIdentify changes in gene expression during infectionAltered expression of Claudin-2 and related pathway components
Promoter analysisStudy transcriptional regulation of Claudin-2 during infectionIdentification of transcription factors (e.g., SP5) regulating Claudin-2 expression
  • Research implications:

    • Understanding viral exploitation of Claudin-2 could lead to novel antiviral strategies

    • Claudin-2 may serve as a receptor or co-receptor for certain viruses

    • Viral modulation of tight junction integrity may facilitate viral spread and pathogenesis

This research direction highlights the importance of Claudin-2 not only in normal physiology but also in host-pathogen interactions.

What factors influence interlaboratory variability in MDCK cell models expressing recombinant Claudin-2, and how can researchers standardize their approaches?

Significant interlaboratory variability exists in MDCK cell models, affecting reproducibility of Claudin-2 studies:

  • Sources of variability:

    • Differences in claudin expression profiles, particularly Claudin-2 levels, which impact tight junction properties

    • Variations in cellularity and cell volume across laboratories

    • Differences in cell passage number and culture conditions

    • Variations in transepithelial electrical resistance (TER) measurements

  • Standardization approaches:

    • Proteomic quantification: Use the total protein approach (TPA) to estimate key morphometric parameters such as monolayer cellularity and volume

    • Claudin expression profiling: Quantify levels of Claudin-2 and other tight junction proteins

    • Reference standards: Include well-characterized cell lines as controls

    • Detailed reporting: Document passage number, culture conditions, and measurement protocols

  • Recommended practices:

    • Establish baseline Claudin-2 expression levels in your MDCK strain

    • Characterize trans-epithelial resistance values for your specific cells

    • Validate antibodies for your specific application

    • Include appropriate controls for each experiment

    • Consider using tet-regulated expression systems for tight control of Claudin-2 levels

Researchers should be aware that the relationship between Claudin-2 expression levels and tight junction modulation affects trans-epithelial resistance, which may impact experimental outcomes and interpretation .

What are the critical quality control parameters for recombinant Claudin-2 protein production and purification?

To ensure consistent, high-quality recombinant Claudin-2 protein for research applications:

  • Expression system selection:

    • Common systems include wheat germ, E. coli, and mammalian cells

    • Considerations: Proper folding, post-translational modifications, yield

    • For functional studies, mammalian expression is often preferred

    • For structural studies or antibody production, bacterial or wheat germ systems may be sufficient

  • Critical quality control parameters:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE, HPLC>95% purity
IdentityMass spectrometry, Western blotConfirmation of expected sequence and molecular weight
Proper foldingCircular dichroism, functional assaysSecondary structure consistent with membrane protein
HomogeneitySize exclusion chromatographyMonodisperse peak
Endotoxin levelsLAL assay<0.1 EU/μg protein for cell-based assays
Functional activityBinding assays, reconstitution studiesDemonstration of expected activities
  • Purification considerations:

    • Membrane proteins like Claudin-2 require detergent solubilization

    • DDM (n-dodecyl-β-D-maltopyranoside) has been successfully used

    • Affinity purification using His-tags is effective

    • Remove detergent if necessary for downstream applications

    • Consider using nanodiscs or liposomes for functional reconstitution

  • Storage conditions:

    • Store at -20°C or -80°C to avoid repeated freeze-thaw cycles

    • Consider addition of stabilizers such as glycerol (50%)

    • Aliquot to avoid repeated freeze-thaw cycles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.