Recombinant Dog D (2) dopamine receptor (DRD2)

Shipped with Ice Packs
In Stock

Description

Introduction to Dog D(2) Dopamine Receptor (DRD2)

The D(2) dopamine receptor in dogs is a G-protein coupled receptor encoded by the DRD2 gene. This receptor serves as the primary target for most antipsychotic drugs and plays a crucial role in dopaminergic signaling pathways . The DRD2 receptor functions by coupling to the Gi subtype of G protein, which inhibits adenylyl cyclase activity, a key mechanism in cellular signal transduction .

Dysregulation of DRD2 has been linked to various neurological and psychiatric disorders in dogs, making it a pivotal biomarker for investigating these conditions and exploring potential treatments . The receptor is integral to the regulation of movement and behavior in dogs, influencing neurotransmission particularly in brain regions involved in motor control and emotional responses .

The dopamine D2 receptor contains seven transmembrane domains that are coupled to G proteins . It plays critical roles in essential brain functions such as learning, memory, locomotion, attention, and motivation . Given its significance in neurological function, recombinant forms of this receptor have become invaluable tools for scientific research and drug development.

Genomic Structure and Protein Features

The genomic and cDNA sequences of the canine DRD2 gene have been successfully cloned and characterized. The genomic DNA is approximately 12.7 kb in size, composed of seven exons and six introns . The corresponding cDNA is about 2.7 kb, encoding a 443 amino acid protein that shares remarkable conservation with other mammalian D2 receptors, exhibiting approximately 95% amino acid identity .

A notable feature within the canine DRD2 gene is a length polymorphism detected in intron 3, which could potentially influence receptor expression or function . This genetic variation might contribute to individual differences in dopamine signaling among dogs and could have implications for breed-specific behavioral traits or susceptibility to certain neurological conditions.

The gene has been assigned the Gene ID 403701 and its protein product is cataloged in the UniProt database under the identifier Q9GJU1 . The molecular characteristics of canine DRD2 are summarized in Table 1.

Table 1: Key Molecular Features of Canine DRD2

FeatureDescription
Genomic DNA size12.7 kb
cDNA size2.7 kb
Exon-intron structure7 exons, 6 introns
Protein length443 amino acids
Amino acid identity to other mammals95%
Gene ID403701
UniProt IDQ9GJU1
Known polymorphismsLength polymorphism in intron 3

Alternative Splicing

Research has identified alternatively spliced forms of canine DRD2 cDNAs, specifically DRD2L (long) and DRD2S (short) . These splice variants show differential expression patterns, with higher levels detected in the midbrain and thalamus . The ratio between the long and short forms appears similar in RT-PCR reactions, suggesting balanced expression of both variants in canine brain tissue .

This alternative splicing pattern is consistent with what has been observed in human and rodent DRD2, indicating evolutionary conservation of this regulatory mechanism across mammalian species . The presence of these splice variants likely contributes to the functional diversity of dopamine signaling in different brain regions.

Expression Systems

Recombinant canine DRD2 is primarily produced using bacterial expression systems, with Escherichia coli (E. coli) being the predominant choice for commercial production . This approach offers advantages in terms of scalability, cost-effectiveness, and relatively high protein yields.

For functional studies, heterologous expression in Xenopus oocytes has proven valuable. Both splice variants of canine DRD2 (DRD2L and DRD2S) have been successfully expressed in this system, allowing for detailed investigations of their electrophysiological properties and ligand interactions .

Protein Modifications and Tags

Commercial recombinant canine DRD2 products typically incorporate affinity tags to facilitate purification and detection. The most common modification is the addition of a histidine (His) tag at the N-terminus of the protein . This tag enables efficient purification using immobilized metal affinity chromatography (IMAC) while minimally impacting the protein's functional properties.

The predicted molecular weight of the recombinant canine DRD2 with an N-terminal His tag is approximately 22.0 kDa, although SDS-PAGE analysis typically shows a band at around 25 kDa, suggesting potential post-translational modifications or the influence of the tag on electrophoretic mobility .

G Protein Coupling and Signal Transduction

The canine DRD2, like its counterparts in other species, functions by coupling to the Gi subtype of G protein . This coupling leads to inhibition of adenylyl cyclase activity, which reduces intracellular cAMP levels and modulates downstream signaling pathways . The function is described as: "Dopamine receptor whose activity is mediated by G proteins which inhibit adenylyl cyclase" .

This inhibitory effect on adenylyl cyclase represents a key mechanism by which DRD2 regulates neuronal excitability and influences neurotransmitter release in the canine brain. The receptor's activity contributes to various physiological processes, including motor control, emotional responses, and cognitive functions .

Electrophysiological Properties

Functional studies have demonstrated that both splice variants of canine DRD2 (DRD2L and DRD2S) activate G protein-coupled inwardly rectifying potassium channel 1 (GIRK1) when heterologously expressed in Xenopus oocytes . This activation occurs through coupling with G(i) protein and exhibits dose-dependent characteristics, confirming the ligand specificity of the receptor .

The electrophysiological properties of canine DRD2 splice variants appear similar to those observed in human and rodent DRD2, suggesting functional conservation across mammalian species . This conservation highlights the evolutionary importance of DRD2-mediated signaling in neurological function.

Protein Interactions

DRD2 engages in various protein-protein interactions that contribute to its signaling functions and regulation. The receptor can form homo- and heterooligomers with DRD4, with the interaction potentially modulating agonist-induced downstream signaling . Additionally, canine DRD2 interacts with several other proteins, including GPRASP1, PPP1R9B, CADPS, CADPS2, CLIC6, ARRB2, and GNAI1 . These interactions are crucial for receptor trafficking, signaling, and desensitization processes.

Basic Research Applications

Recombinant canine DRD2 serves as a valuable tool for investigating the fundamental properties of dopamine receptors. It can be used to study:

  • Structure-function relationships of dopamine receptors

  • Ligand binding characteristics and specificity

  • G protein coupling and activation mechanisms

  • Receptor oligomerization and protein-protein interactions

  • Comparative analysis of dopamine signaling across species

The protein has been particularly useful in heterologous expression systems for electrophysiological studies, allowing detailed characterization of its functional properties .

Diagnostic and Therapeutic Applications

The Dog D-2 Dopamine Receptor (DRD2) ELISA Kit, which may incorporate recombinant DRD2 as a standard, enables precise measurement of DRD2 levels in canine serum, plasma, and cell culture supernatants . This diagnostic capability is valuable for investigating neurological and psychiatric disorders in dogs that involve dopaminergic dysregulation.

From a therapeutic perspective, recombinant canine DRD2 can facilitate the screening and development of compounds targeting this receptor. Given that DRD2 is the primary target for most antipsychotic drugs , recombinant versions of the protein are invaluable for developing and refining medications for canine neurological and behavioral disorders.

Immunological Applications

Commercial recombinant canine DRD2 products are often marketed for use as positive controls in immunoassays or as immunogens for antibody production . The availability of highly purified recombinant protein (>95% by SDS-PAGE) enables the generation of specific antibodies against canine DRD2, which can then be employed in various research and diagnostic applications.

Sequence Homology

The canine DRD2 protein exhibits approximately 95% amino acid identity with other mammalian D2 receptors , reflecting strong evolutionary conservation. This high degree of sequence similarity suggests that the essential structural and functional properties of DRD2 have been maintained across mammalian evolution.

The conservation extends to key functional domains, including the seven transmembrane regions, ligand-binding pocket, and G protein coupling interface. This structural preservation underscores the fundamental importance of DRD2 in dopaminergic signaling across species.

Functional Conservation

Both splice variants of canine DRD2 (DRD2L and DRD2S) activate GIRK1 potassium channels through G(i) protein coupling, similar to what has been observed with human and rodent DRD2 . This functional conservation extends to the inhibitory effect on adenylyl cyclase activity, which represents a core mechanism of DRD2 signaling across species .

The observed functional similarities between canine and human DRD2 suggest that insights gained from studies using recombinant canine DRD2 may have translational relevance for human health research, particularly in the context of neuropsychiatric disorders and drug development.

Future Research Directions

The field of canine DRD2 research continues to evolve, with several promising avenues for future investigation:

Genetic Variation and Disease Associations

Further investigation of the length polymorphism detected in intron 3 of the canine DRD2 gene and other genetic variations could reveal associations with specific canine behavioral traits or neurological disorders. Such genetic studies might help identify predispositions to certain conditions and inform breeding practices.

Development of Canine-Specific DRD2-Targeted Therapeutics

The availability of recombinant canine DRD2 facilitates the screening and development of compounds specifically optimized for veterinary applications. Such efforts could lead to improved medications for conditions involving dopaminergic dysregulation in dogs, potentially with fewer side effects than human-targeted drugs currently used in veterinary medicine.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
DRD2; D(2 dopamine receptor; Dopamine D2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
MDPLNLSWYDDDLESQNWSRPFNGSEGKPGKPHYNYYAMLLTLLIFIIVFGNVLVCMAVS REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPLLFGLNNTDQN ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTERSSRAFRANLKAPL KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP SHHQLTLPDPSHHGLHSTADSPAKPEKNGHAKDHPKIAKIFEIQSMPNGKTRTSLKTMSR RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCECNIPPVLYSAFTWLGYVNSA VNPIIYTTFNIEFRKAFLKILHC
Uniprot No.

Target Background

Function
The dopamine receptor D2 is a G protein-coupled receptor that inhibits adenylyl cyclase. It positively regulates postnatal regression of retinal hyaloid vessels by suppressing VEGFR2/KDR activity downstream of OPN5.
Gene References Into Functions
  1. Expression and functional role of D2 and somatostatin receptors in corticotroph adenoma cells. PMID: 18483151
  2. Differential sensitivity to established and novel dopamine D2/5-HT(1A) antipsychotic compounds in a canine model of emesis. PMID: 18773888
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of canine DRD2 and how does it compare to other species?

The canine DRD2 gene consists of seven exons and six introns with a genomic DNA size of approximately 12.7 kb and cDNA size of 2.7 kb. The gene encodes a 443 amino acid protein that shares remarkable homology (95% amino acid identity) with other mammalian D2 receptors . Like other dopamine receptors, canine DRD2 belongs to the G-protein coupled receptor family with seven transmembrane domains . This high conservation across species makes the canine DRD2 a valuable model for comparative studies of dopaminergic signaling mechanisms.

What are the known splice variants of canine DRD2 and their functional significance?

Two alternatively spliced variants of canine DRD2 have been characterized: DRD2L (long) and DRD2S (short) . Both forms show elevated expression in the midbrain and thalamus, with approximately equal expression ratios as determined by RT-PCR analysis . Functionally, both variants couple with G(i)-type heterotrimeric GTP binding proteins to activate inwardly rectifying potassium channels (GIRK1) in a dose-dependent manner . This activation pattern demonstrates their ligand specificity and functional conservation with human and rodent D2 receptor variants, making them valuable for comparative pharmacological studies.

How are canine DRD2 receptors distributed in the brain?

Canine DRD2 receptors show enriched expression in striatal regions, similar to other mammalian species, with particularly high levels detected in the midbrain and thalamus . This distribution pattern correlates with the dopaminergic pathways involved in movement control, cognition, and reward processing. Understanding this distribution is essential for researchers designing region-specific studies or developing targeted therapeutic approaches for canine neurological disorders.

What expression systems are most effective for studying recombinant canine DRD2?

For functional studies of canine DRD2, the Xenopus oocyte expression system has proven effective, particularly for electrophysiological characterization of channel activity . This system allows robust expression of both DRD2L and DRD2S variants and enables direct measurement of G-protein coupling and downstream channel activation. For protein production and structural studies, wheat germ expression systems have been successfully used for human DRD2 and may be adapted for canine variants. When selecting an expression system, researchers should consider the specific experimental endpoints, whether structural characterization, ligand binding, or signaling pathway analysis.

What are the optimal methods for cloning and expressing functional canine DRD2?

For successful cloning and expression of functional canine DRD2:

  • Isolate high-quality RNA from canine brain tissue, preferably from regions with high DRD2 expression (midbrain, thalamus)

  • Perform RT-PCR using primers designed from conserved regions of mammalian DRD2 sequences

  • Clone the amplified products into appropriate expression vectors containing strong promoters (e.g., CMV for mammalian expression)

  • For functional studies in cell lines, transfect into HEK293 or similar cell lines with low endogenous dopamine receptor expression

  • For electrophysiological studies, use the Xenopus oocyte system with co-expression of appropriate G proteins and channel partners like GIRK1

These methods should yield functional receptors suitable for pharmacological and signaling studies.

How can researchers effectively differentiate between DRD2L and DRD2S splice variants in experimental settings?

To effectively differentiate between DRD2L and DRD2S variants:

  • RT-PCR Analysis: Design primers flanking the alternatively spliced region to generate different-sized amplicons for each variant

  • Quantitative RT-PCR: Develop variant-specific primers or probes targeting the junction regions unique to each splice variant

  • Western Blotting: Use antibodies capable of distinguishing between the variants based on size differences

  • Functional Assays: Compare G-protein coupling efficiency and arrestin recruitment, as these parameters often differ between splice variants

For precise quantification of the ratio between variants, digital droplet PCR or RNA-seq analysis with splice-junction aware algorithms may provide the most accurate results.

How does canine DRD2 couple to G proteins and what downstream pathways are activated?

Canine DRD2 receptors couple primarily to G(i)-type G proteins, leading to inhibition of adenylyl cyclase and subsequent reduction in cAMP levels . This coupling triggers several downstream signaling cascades:

  • Activation of inwardly rectifying potassium channels (GIRK1), resulting in membrane hyperpolarization

  • Inhibition of voltage-gated calcium channels

  • Modulation of MAPK/ERK signaling pathways

The activation of these pathways is dose-dependent and demonstrates clear ligand specificity . Both DRD2L and DRD2S variants effectively couple to G(i) proteins, though subtle differences in coupling efficiency may exist between the variants that could influence signaling outcomes in different neuronal populations.

What methodologies are most effective for measuring canine DRD2 signaling in vitro?

For comprehensive characterization of canine DRD2 signaling:

Assay TypeMethodologyMeasured ParameterAdvantages
G-protein Coupling[35S]GTPγS BindingG-protein activationDirect measure of receptor-G protein interaction
cAMP SignalingELISA or BRET-based sensorsAdenylyl cyclase inhibitionQuantitative, real-time measurements
Potassium Channel ActivityPatch-clamp electrophysiologyGIRK channel activationDirect functional readout with high temporal resolution
Arrestin RecruitmentBRET or enzyme complementationReceptor desensitizationMeasures regulatory pathway activation
Receptor InternalizationFluorescence microscopyReceptor traffickingVisualizes spatial dynamics

When designing these assays, researchers should consider using known DRD2 agonists (e.g., quinpirole, bromocriptine) and antagonists (e.g., haloperidol, sulpiride) at varying concentrations to establish dose-response relationships.

What are the important considerations when evaluating arrestin recruitment to canine DRD2?

When evaluating arrestin recruitment to canine DRD2:

  • Consider potential differences between DRD2L and DRD2S variants, as the intracellular loop that differs between variants can affect arrestin binding

  • Utilize BRET-based assays that tag the receptor with a donor fluorophore and arrestin with an acceptor

  • Account for the kinetics of recruitment, as some variants may show altered temporal profiles of arrestin association

  • Compare recruitment efficiency with the human receptor to identify species-specific differences

Research on human DRD2 variants has shown that mutations can significantly reduce arrestin3 recruitment, as seen with the p.Ile212Phe variant . Similar mutations in canine DRD2 may produce comparable alterations in arrestin recruitment, potentially affecting receptor desensitization and internalization.

What polymorphisms have been identified in canine DRD2 and how might they affect receptor function?

A length polymorphism has been identified in intron 3 of the canine DRD2 gene . While intron polymorphisms may not directly alter the protein sequence, they can potentially affect:

  • Splicing efficiency between DRD2L and DRD2S variants

  • mRNA stability and expression levels

  • Transcription factor binding if located near regulatory elements

Researchers investigating these polymorphisms should consider:

  • Population distribution of variants across different dog breeds

  • Correlation with behavioral or neurological phenotypes

  • Potential effects on DRD2 expression levels in different brain regions

  • Comparative analysis with equivalent polymorphisms in human or rodent DRD2 genes

How can researchers effectively model DRD2-related movement disorders using canine models?

To model DRD2-related movement disorders using canine models:

  • Genetic Approaches:

    • Investigate naturally occurring DRD2 variants in dogs with movement abnormalities

    • Consider CRISPR/Cas9 gene editing to introduce specific mutations (e.g., equivalent to human p.Ile212Phe) that cause hyperkinetic disorders

  • Pharmacological Approaches:

    • Use DRD2 antagonists to induce acute Parkinsonian-like symptoms

    • Administer DRD2 agonists to potentially induce dyskinesias or stereotypies

  • Functional Assessment:

    • Employ validated canine behavioral scales to quantify movement abnormalities

    • Utilize motion capture or accelerometry for objective measurement of movement parameters

    • Consider functional neuroimaging to assess striatal activity

When interpreting results, researchers should acknowledge that the gain-of-function variants like p.Ile212Phe identified in humans may produce distinct phenotypes in canine models due to species-specific differences in neural circuitry .

How can cell-specific targeting of canine DRD2-expressing neurons be achieved for in vivo studies?

For precise targeting of canine DRD2-expressing neurons:

  • Viral Vector Approaches:

    • Develop AAV vectors containing DRD2 promoter elements to drive transgene expression

    • Consider adapting MiniPromoters like Ple389 that have shown selectivity for D2-type MSNs in mice and non-human primates

  • CRISPR-Based Approaches:

    • Utilize CRISPR activation or inhibition systems driven by the DRD2 promoter

    • Implement conditional expression systems (e.g., Cre-dependent) for temporal control

  • Pharmacogenetic Approaches:

    • Express DREADDs or optogenetic tools under DRD2 regulatory elements

    • Utilize DRD2-targeting ligands conjugated to bioactive molecules

For optimal specificity, researchers should validate the selectivity of their targeting approach using co-localization studies with established DRD2 markers in canine brain tissue.

What are the current challenges in developing DRD2-targeted therapeutics for canine neurological disorders?

Key challenges in developing DRD2-targeted therapeutics for canine neurological disorders include:

  • Selectivity Challenges:

    • Achieving specificity among dopamine receptor subtypes

    • Targeting specific splice variants (DRD2L vs. DRD2S)

    • Regional selectivity within the brain

  • Delivery Challenges:

    • Blood-brain barrier penetration for small molecules

    • Targeted delivery of gene therapies to specific brain regions

    • Achieving stable, long-term expression with viral vectors

  • Translational Challenges:

    • Differences in drug metabolism between canines and humans

    • Potential variations in signaling cascades downstream of DRD2

    • Ethical considerations in experimental therapeutics for companion animals

Researchers addressing these challenges should consider collaborative approaches between veterinary neurology, pharmacology, and gene therapy fields to develop comprehensive solutions.

How can differential allelic expression analyses be applied to study canine DRD2 regulation?

Differential allelic expression (DAE) analysis can provide powerful insights into cis-acting regulatory mechanisms affecting canine DRD2 expression:

  • Methodology Approach:

    • Identify heterozygous coding SNPs within the canine DRD2 gene to serve as reporter alleles

    • Isolate RNA from relevant brain regions (e.g., striatum, midbrain, thalamus)

    • Perform allele-specific qPCR or RNA-seq to quantify the relative expression of each allele

    • Compare with genomic DNA to identify imbalances in expression

  • Applications:

    • Identify breed-specific differences in DRD2 regulation that may correlate with behavioral traits

    • Investigate tissue-specific regulatory mechanisms

    • Discover novel cis-acting elements that could be targeted for therapeutic modulation

Human studies have demonstrated significant DAE for DRD2, with some samples showing at least 2-fold differences in expression driven by cis-acting loci . Similar analyses in canine models could reveal important regulatory mechanisms with potential implications for behavior and neurological function.

What are the most promising future research directions for canine DRD2 studies?

The most promising future research directions include:

  • Comprehensive comparative analysis of canine DRD2 with human and rodent orthologs to better understand evolutionary conservation of dopaminergic signaling

  • Investigation of breed-specific variations in DRD2 structure and function that may correlate with behavioral differences

  • Development of selective ligands or therapies targeting specific canine DRD2 variants for veterinary applications

  • Exploration of canine models for human DRD2-related movement disorders to better understand pathophysiology and test novel interventions

  • Integration of advanced genetic tools and imaging approaches to study DRD2 function in the living canine brain

These directions will likely advance both basic understanding of dopaminergic signaling and translational applications for both canine and human health.

How might findings from canine DRD2 research translate to human applications?

The high degree of conservation (95% amino acid identity) between canine and human DRD2 suggests strong translational potential:

  • Naturally occurring variations in canine DRD2 could serve as models for human movement disorders and other dopamine-related conditions

  • Pharmacological responses in canine systems may predict human responses to novel DRD2-targeting therapeutics

  • Regulatory mechanisms identified in canine DRD2 expression studies could inform human genomic investigations

  • Successful gene therapy approaches targeting canine DRD2-expressing neurons could be adapted for human applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.