Recombinant Dog E-selectin (SELE)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Dog E-selectin (SELE)

Recombinant Dog E-selectin (SELE) is a genetically engineered form of the E-selectin protein, specifically designed for canine applications. E-selectin is a vascular adhesion molecule expressed by endothelial cells in response to inflammation or injury, playing a crucial role in leukocyte recruitment and adhesion during inflammatory processes . While specific research on recombinant dog E-selectin is limited, understanding its human and murine counterparts provides valuable insights into its potential functions and applications.

Function and Role of E-selectin

E-selectin facilitates the initial capture and rolling of leukocytes along the endothelial surface, a critical step in their migration to sites of inflammation . This process is mediated by the interaction between E-selectin and its ligands on leukocytes, such as PSGL-1, ESL-1, and CD44 . In humans and mice, E-selectin expression is induced by inflammatory cytokines like TNF-α, which activate NF-κB response elements in the E-selectin gene promoter .

Potential Applications of Recombinant Dog E-selectin

Recombinant proteins are often used in research and therapeutic applications to study biological processes or to develop treatments. For recombinant dog E-selectin, potential applications could include:

  • Inflammatory Disease Models: Studying canine inflammatory diseases using recombinant E-selectin could provide insights into human conditions, given the similarities in vascular biology.

  • Vaccine Development: Understanding how E-selectin interacts with leukocytes could inform strategies for vaccine delivery or immune modulation.

  • Cancer Research: E-selectin's role in mediating leukocyte adhesion might be relevant in studying canine cancers, similar to its implications in human acute myeloid leukemia (AML) .

Research Findings and Data

While specific data on recombinant dog E-selectin is not available, research on E-selectin in other species highlights its importance in inflammation and disease. For example, in AML, E-selectin expression is increased on bone marrow endothelial cells, contributing to chemotherapy resistance by facilitating the survival of leukemic blasts .

SpeciesE-selectin RoleKey Findings
HumanInflammation, AMLIncreased expression in AML, associated with chemotherapy resistance .
MouseInflammationEssential for leukocyte adhesion and recruitment to inflammatory sites .
DogPotential researchCould be used in studying canine inflammatory diseases or cancer models.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SELE; E-selectin; CD62 antigen-like family member E; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD antigen CD62E
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-611
Protein Length
Full Length of Mature Protein
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Target Names
Target Protein Sequence
WSYNASTEAMTFDEASTYCQQRYTHLVAIQNQEEIKYLNSMFTYTPTYYWIGIRKVNKKWTWIGTQKLLTEEAKNWAPGEPNNKQNDEDCVEIYIKRDKDSGKWNDERCDKKKLALCYTAACTPTSCSGHGECVETVNNYTCKCHPGFRGLRCEQVVTCQAQEAPEHGSLVCTHPLGTFSYNSSCFVSCDKGYLPSSTEATQCTSTGEWSASPPACNVVECSALTNPCHGVMDCLQSSGNFPWNMTCTFECEEGFELMGPKRLQCTSSGNWDNRKPTCKAVTCGAIGHPQNGSVSCSHSPAGEFSVRSSCNFTCNEGFLMQGPAQIECTAQGQWSQQVPVCKASQCKALSSPERGYMSCLPGASGSFQSGSSCEFFCEKGFVLKGSKTLQCGLTGKWDSEEPTCEAVKCDAVQQPQDGLVRCAHSSTGEFTYKSSCAFSCEEGFELHGSAQLECTSQGQGVTGGPSCQVVQCFKSGSFRKDEHKLQGEPVFGAVCAFACPEGWTLNGSAALMCDATGHWSGMLPTCEAPTESSIPLAVGLTAGGTSLLTVASFLLWLLKRLRKRAKKFVPASSCQSLQSDGSYHMPCSI
Uniprot No.

Target Background

Function

Recombinant Dog E-selectin (SELE) is a cell-surface glycoprotein involved in immunoadhesion. It mediates neutrophil adhesion to cytokine-activated endothelium through interaction with SELPLG/PSGL1. It may also play a role in capillary morphogenesis.

Database Links
Protein Families
Selectin/LECAM family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is dog E-selectin (SELE) and what are its main functions?

Dog E-selectin (SELE), also known as CD62 antigen-like family member E or endothelial leukocyte adhesion molecule 1 (ELAM-1), is a cell-surface glycoprotein primarily expressed on activated endothelial cells. It plays a critical role in inflammatory responses by mediating the adhesion of blood neutrophils to cytokine-activated endothelium through interaction with PSGL1/SELPLG . As a C-type lectin, dog E-selectin contains an essential calcium ion in its ligand-binding pocket and recognizes specific carbohydrate structures, particularly sialyl Lewis x (sLex) .

E-selectin functions as a key adhesion molecule involved in:

  • Leukocyte recruitment and migration during inflammation

  • Initial tethering and rolling of neutrophils on vascular endothelium

  • Facilitating extravasation of leukocytes from blood vessels to sites of inflammation

  • Potential roles in capillary morphogenesis and angiogenesis

Elevated levels of E-selectin have been linked to various inflammatory conditions in dogs, making it a valuable biomarker for studying these conditions and potential therapeutic interventions .

How does E-selectin structure compare across species?

While comprehensive structural comparisons between canine and human E-selectin are still emerging, insights can be drawn from comparisons between other species. For example, porcine E-selectin shares 75% amino acid identity with human E-selectin , suggesting significant conservation across mammalian species.

All mammalian E-selectins share a common domain organization:

  • N-terminal lectin domain (responsible for carbohydrate recognition)

  • Epidermal growth factor (EGF)-like domain

  • Multiple short consensus repeat (SCR) domains

  • Transmembrane region

  • Cytoplasmic tail

The lectin domain contains the calcium-dependent binding site that recognizes sialylated and fucosylated ligands like sialyl Lewis x. Species-specific differences typically occur in the amino acid sequences within these domains, potentially affecting binding affinities and specificities for ligands.

How is E-selectin expression regulated in endothelial cells?

E-selectin expression is primarily regulated at the transcriptional level in response to inflammatory stimuli. Inflammatory cytokines, particularly TNF-α, induce E-selectin expression through activation of transcription factors such as NF-κB . Studies involving porcine endothelial cells revealed that they respond strongly to human TNF-α but not to human IL-1, suggesting species-specific differences in cytokine responsiveness .

Notable regulatory characteristics include:

  • Transient expression pattern, with levels typically peaking 4-6 hours after cytokine stimulation and decreasing thereafter

  • E-selectin knockout mice display markedly fewer arrested leukocytes after TNF-α stimulation, consistent with E-selectin's role in cell arrest due to integrin activation

  • Mice with gene deletions of both E-selectin and P-selectin show marked decreases in neutrophil rolling on endothelium after TNF-α challenge

How can recombinant dog E-selectin be used to study canine inflammatory conditions?

Recombinant dog E-selectin serves as a valuable tool for studying inflammatory conditions in canine models through multiple experimental approaches:

  • Binding assays to characterize interactions between canine leukocytes and endothelium, providing insights into species-specific aspects of inflammatory cell recruitment

  • Development of blocking antibodies against recombinant dog E-selectin to evaluate the therapeutic potential of interrupting E-selectin-mediated adhesion

  • Competitive binding assays to screen for small molecule inhibitors or glycomimetics that might serve as anti-inflammatory therapeutics

  • Flow chamber assays using immobilized recombinant E-selectin to study leukocyte rolling and adhesion under physiological shear conditions

  • Utilizing research findings related to enforced E-selectin ligand expression via exofucosylation of T cells (as demonstrated in research with human FUT6), which has been shown to enhance T cell tumor homing and anti-tumor immunity in various cancer models

The ELISA kit for dog E-selectin provides a highly sensitive and specific assay for accurately detecting E-selectin levels in dog serum, plasma, and cell culture supernatants, making it useful for quantifying this biomarker in various research contexts .

What methods are most effective for producing functional recombinant dog E-selectin?

Based on methodologies described for similar recombinant proteins, the following approach is recommended:

Expression System Selection:

  • Mammalian expression systems are preferred to ensure proper post-translational modifications, especially glycosylation

  • COS cells have been successfully used for porcine E-selectin expression and would likely be suitable for canine E-selectin

  • For stable expression, retroviral transduction systems using packaging cells like Plat-E offer efficient gene delivery

Vector Design:

  • Use vectors containing strong promoters such as CMV

  • For studies requiring the soluble extracellular portion, construct designs should exclude the transmembrane domain

  • Consider adding affinity tags (His-tag or Fc fusion) to facilitate purification

Transfection Protocol:

  • Optimize with lipid-based reagents or polyethylenimine (PEI) at a DNA:transfection reagent ratio of approximately 1:3

  • For retroviral approaches, follow protocols similar to those described for other proteins:

    • Transfect packaging cells (e.g., Plat-E) with the expression construct

    • Collect viral supernatants at 36-40h and 60-64h after transfection

    • Concentrate the retroviral vector using appropriate concentrators

Critical Considerations:

  • Include calcium (1-2 mM) in all buffers to maintain the lectin domain structure

  • Verify functionality through binding assays with known ligands or leukocytes

  • Use glycosylation analysis to confirm proper post-translational modifications

What are the challenges in maintaining biological activity during purification?

Maintaining the biological activity of recombinant dog E-selectin during purification presents several significant challenges:

  • Calcium dependency: The lectin domain requires calcium for proper folding and ligand binding. All purification buffers must contain adequate calcium concentrations (typically 1-2 mM CaCl₂), and chelating agents like EDTA must be strictly avoided.

  • Disulfide bond integrity: Multiple disulfide bonds in E-selectin's structure must be maintained, requiring non-reducing conditions throughout purification.

  • Temperature sensitivity: Purification steps should be conducted at 4°C when possible to prevent denaturation.

  • Aggregation prevention: During concentration steps, protein aggregation can be mitigated by including non-ionic detergents or stabilizing agents like glycerol in buffers.

  • Proteolytic degradation: Include protease inhibitor cocktails to prevent degradation by endogenous proteases released during cell lysis.

  • Glycosylation preservation: Buffer conditions must not alter the complex glycosylation patterns essential for E-selectin function.

Functional validation at multiple purification stages is essential, using binding assays similar to methods described for porcine E-selectin research .

How should researchers design experiments to evaluate E-selectin-mediated cell adhesion?

To rigorously evaluate E-selectin-mediated cell adhesion, experiments should include both static and dynamic assessment methods:

Static Adhesion Assays:

  • Coat microwell plates with recombinant dog E-selectin (1-10 μg/ml)

  • Block with BSA to prevent non-specific binding

  • Add isolated canine leukocytes (particularly neutrophils) and incubate for 30-60 minutes

  • Wash to remove non-adherent cells

  • Quantify adherent cells using appropriate methods (colorimetric assays, fluorescent labeling, microscopic counting)

Dynamic Flow Chamber Assays:

  • Assemble recombinant E-selectin-coated surfaces in a parallel plate flow chamber

  • Perfuse leukocyte suspensions at defined physiological shear rates (1-2 dyn/cm²)

  • Use video microscopy for real-time analysis of:

    • Cell rolling velocities

    • Tethering frequencies

    • Firm adhesion events

Essential Controls:

  • Calcium chelation (using EDTA) to confirm calcium dependency

  • Blocking with anti-E-selectin antibodies to verify specificity

  • Enzymatic removal of sialic acid from leukocytes using neuraminidase

  • Comparison with other selectins (P-selectin and L-selectin)

  • Include human and canine leukocytes to identify species-specific differences

This comprehensive approach enables robust assessment of E-selectin-mediated adhesion mechanisms specific to canine inflammatory responses.

What methods are most reliable for quantifying recombinant dog E-selectin expression and activity?

For comprehensive assessment, both protein quantification and functional activity should be measured:

Protein Expression Quantification:

  • Enzyme-linked immunosorbent assay (ELISA) using anti-dog E-selectin antibodies

    • Commercial kits offer detection ranges of 0.625-40 ng/mL with sensitivities around 0.27 ng/mL

  • Western blotting for protein integrity and molecular weight verification

  • Flow cytometry using fluorescently labeled antibodies for cell surface expression analysis

Functional Activity Assessment:

  • Binding assays measuring adhesion of canine neutrophils to immobilized recombinant E-selectin

  • Surface plasmon resonance (SPR) for real-time, label-free quantification of binding kinetics

  • Solid-phase binding assays using plate-bound E-selectin and soluble ligands (e.g., sLex-conjugated proteins)

Validation Methods:

  • Verify calcium dependency by demonstrating loss of activity with EDTA (2-5 mM) and restoration with excess calcium

  • Generate dose-response curves for both protein concentration and binding activity

  • Compare binding to known E-selectin ligands (like PSGL-1) as positive controls

These complementary approaches provide a comprehensive assessment of both expression levels and functional integrity.

How can researchers use enforced E-selectin ligand expression to enhance cell targeting?

Based on recent research findings, enforced E-selectin ligand expression on cells can significantly enhance their targeting and tissue infiltration capabilities. This approach has particular relevance for adoptive cell therapies:

Methods for Enforced E-selectin Ligand Installation:

  • Exofucosylation: Direct cell surface treatment with human α1–3-fucosyltransferase (FUT6)

    • This approach has been shown to enhance the presentation of sialyl Lewis X (sLex) on cell surfaces

    • In studies with T cells, this modification significantly improved their parenchymal infiltration of target sites

  • Golgi-fucosylation: Overexpression of FUT6 targeted to the Golgi apparatus

    • While this approach also increases E-selectin binding, research has shown it may not enhance tissue infiltration as effectively as exofucosylation

Demonstrated Benefits:

  • Exofucosylated T cells showed significantly improved therapeutic efficacy in various cancer models, including:

    • Subcutaneous solid tumors

    • Lymphoma and leukemia

    • Lung and bone marrow metastases

  • The modification resulted in preferential migration to E-selectin-expressing lesional tissues within 24 hours of adoptive transfer

  • Enhanced E-selectin ligand display persisted for approximately 48 hours on murine cells and up to 7 days on human cells

Implementation Protocol:
Researchers can apply retroviral transduction methods similar to those described in the literature:

  • Activate target cells appropriately (e.g., T cells with specific activators)

  • Transduce with retroviral vectors containing FUT6

  • Expand the cells in appropriate media with cytokines

  • Verify increased E-selectin ligand expression before use

This approach represents a promising strategy to improve targeted cell delivery in various research and therapeutic applications.

How should researchers interpret E-selectin expression data across different experimental conditions?

When analyzing E-selectin expression data, several key factors must be considered:

Temporal Dynamics:

  • E-selectin expression is typically transient, peaking at 4-6 hours post-stimulation

  • Studies sampling at different time points may yield different results

  • Time-course experiments are essential for capturing the complete expression profile

Methodological Considerations:

  • Different detection techniques (immunohistochemistry, flow cytometry, qRT-PCR, ELISA) measure different aspects of expression

  • Multi-modal validation using standardized protocols is recommended

  • Sample preparation procedures can significantly impact detection

Stimulus-Specific Responses:

  • Different inflammatory stimuli may induce varying levels of E-selectin expression

  • Species-specific differences in cytokine responsiveness have been observed (e.g., porcine endothelial cells respond to human TNF-α but not human IL-1)

  • Concentration and duration of stimuli should be standardized

Tissue-Specific Variations:

  • E-selectin expression varies across different vascular beds

  • Site-specific analysis is required rather than generalization across all endothelial cells

  • E-selectin knockout mice show reduced proliferation of hematopoietic stem cells and enhanced survival after cytotoxic treatments or radiation

When reporting findings, researchers should clearly document these factors and implement standardized reporting formats that include detailed methodological descriptions and precise timing of sample collection.

What controls are essential for validating E-selectin ligand interactions?

A comprehensive set of controls is essential for validating E-selectin ligand interactions:

Calcium Dependency Controls:

  • Parallel experiments with calcium-containing buffer (1-2 mM Ca²⁺) and calcium-free buffer with chelating agents (2-5 mM EDTA/EGTA)

  • Genuine E-selectin binding should be abolished without calcium and restored upon calcium repletion

Antibody Blocking Controls:

  • Anti-E-selectin blocking antibodies targeting the lectin domain

  • Both monoclonal and polyclonal antibodies should be tested

Enzymatic Treatment Controls:

  • Sialidase (neuraminidase) to remove sialic acids

  • α1,3/4-Fucosidase to remove fucose residues

  • These treatments should reduce specific binding without affecting non-specific interactions

Recombinant Enzyme Modification:

  • As demonstrated with FUT6-mediated fucosylation, enzymatic addition of specific carbohydrate structures enhances binding

  • This approach confirms the importance of these structures for E-selectin recognition

Species Cross-Reactivity Controls:

  • Test human, canine, and other species' E-selectin in parallel

  • This identifies species-specific interaction patterns

Concentration Gradients:

  • Perform dose-response experiments with varying concentrations of E-selectin and/or ligands

  • Specific binding typically demonstrates saturation kinetics

Flow Condition Controls:

  • For dynamic binding assays, vary shear stress levels

  • Selectin-ligand interactions show characteristic catch-bond behavior with optimal binding at physiological shear ranges

These comprehensive controls ensure that observations are specifically attributable to E-selectin-ligand interactions rather than experimental artifacts.

How does E-selectin function in different canine disease models?

E-selectin plays diverse roles across various canine disease models, with expression patterns and functional impact varying by condition:

Inflammatory Conditions:

  • E-selectin expression is rapidly upregulated on endothelial cells following stimulation with inflammatory cytokines, particularly TNF-α

  • This upregulation facilitates neutrophil recruitment to sites of acute inflammation

  • Studies in gene knockout mice reveal that E-selectin deficiency results in markedly fewer arrested leukocytes after TNF-α stimulation

Cancer Models:

  • Research has demonstrated that E-selectin plays a crucial role in tumor cell extravasation and metastasis

  • The interaction between endothelial E-selectin and its ligands on tumor cells supports the formation of new metastatic sites

  • Enhanced E-selectin ligand display on therapeutic T cells significantly improves their tumor-specific homing and therapeutic efficacy

  • This improved efficacy has been demonstrated across diverse cancer models including solid tumors, lymphoma, leukemia, and metastatic disease

Vascular Disorders:

  • E-selectin contributes to microvascular dysfunction by promoting leukocyte adhesion and subsequent endothelial damage

  • Mice with deletions of both E-selectin and P-selectin show marked decreases in neutrophil rolling on endothelium after inflammatory challenge

Infectious Disease:

  • E-selectin mediates the initial steps of leukocyte recruitment during infection

  • Double knockout mice lacking both E-selectin and P-selectin are susceptible to infection and develop ulcerative dermatitis

Understanding these differential roles across disease models is essential for developing targeted therapeutic strategies and interpreting experimental results in canine models.

How can researchers use E-selectin as a target for therapeutic development?

E-selectin presents multiple opportunities as a target for therapeutic development:

Blocking Strategies:

  • Development of antibodies specifically targeting canine E-selectin to interrupt leukocyte adhesion

  • Small molecule inhibitors that block the binding of sialyl Lewis X to E-selectin

  • Glycomimetics that competitively inhibit natural ligand binding

Enhanced Cell Targeting:

  • Enforced E-selectin ligand installation (via exofucosylation) on therapeutic cells enhances their tissue-specific homing

  • This approach has shown significant improvement in therapeutic efficacy across various disease models

  • The modification persists for approximately 48 hours on murine cells and up to 7 days on human cells

Monitoring Disease Activity:

  • E-selectin expression levels can serve as biomarkers for inflammatory activity

  • ELISA assays can accurately detect E-selectin levels in dog serum, plasma, and cell culture supernatants

  • The detection range of 0.625-40ng/mL with sensitivity of 0.27ng/mL allows for precise measurement

Comparative Model Development:

  • Understanding species-specific differences in E-selectin signaling and expression (as seen between porcine and human models) enables more accurate translation between canine studies and human applications

  • This is particularly important when developing therapeutics that may be intended for eventual human use

When pursuing these therapeutic strategies, researchers should carefully consider the transient nature of E-selectin expression and the tissue-specific differences in its regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.